Recombinant Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

TNFSF11/RANKL interacts with its receptor RANK and decoy receptor osteoprotegerin (OPG) to mediate physiological and pathological processes:

Bone Remodeling

  • Osteoclast Differentiation: Induces osteoclastogenesis via RAW 264.7 monocytes/macrophages, with ED₅₀ values ranging from 0.5–2 ng/mL (E. coli-derived) to 5–15 ng/mL (HEK293-derived with cross-linking antibodies) .

  • Pathological Involvement: Overexpression linked to rheumatoid arthritis, psoriatic arthritis, and osteoporosis .

Immune System

  • Lymphoid Organogenesis: Essential for thymus, lymph node, and mammary gland development .

  • T-Cell Activation: Enhances T-cell growth and dendritic cell function .

Table 2: Biological Functions and Associated Pathways

FunctionPathway/ReceptorKey Effects
OsteoclastogenesisRANK-NF-κB/AP-1Bone resorption, osteoporosis
Lymph Node DevelopmentRANK signalingOrganogenesis, immune cell maturation
Mammary Gland DevelopmentRANK-RANKL axisLobulo-alveolar formation during pregnancy

Applications in Research

TNFSF11/RANKL is employed in diverse experimental contexts:

Cell Culture and Bioassays

  • Osteoclast Differentiation: Used with M-CSF to differentiate bone marrow cells or RAW 264.7 cells into osteoclasts .

  • ELISA and Western Blot Standards: Serves as a control for detecting endogenous TNFSF11 .

Transgenic Models

  • RANKL Overexpression: Transgenic mice models recapitulate human bone diseases and test therapeutic interventions (e.g., OPG) .

Table 3: Representative Research Applications

ApplicationModel/MethodOutcome
Osteoclast DifferentiationRAW 264.7 cells + M-CSFMature osteoclasts with resorption pits
Lymph Node DevelopmentRANKL-deficient miceSevere osteopetrosis and lymphopenia
Drug Efficacy TestingRANKL inhibitors (e.g., OPG)Reduced bone resorption in arthritis models

Osteoclast Signaling

  • RANKL-RANK Interaction: Activates NF-κB, c-jun N-terminal kinase (JNK), and TRAF6 pathways, promoting osteoclast survival and activity .

  • Cross-Talk with Other Pathways: Interacts with Wnt/β-catenin and BMP signaling to modulate bone homeostasis .

Disease Models

  • Arthritis and Osteoporosis: RANKL overexpression in transgenic mice induces bone erosion and cartilage damage, mimicking human autoimmune arthritis .

  • Immune Dysregulation: RANKL-deficient mice exhibit defective T/B cell development and lymph node formation .

Table 5: TNFSF11-Associated Pathways and Interactions

PathwayKey MoleculesBiological Impact
NF-κB SignalingRANK, TRAF6, IKK complexOsteoclast differentiation
Cytokine Receptor InteractionIL-17, TNFα, IL-1βInflammatory bone resorption
Wnt/β-Cateninβ-Catenin, LRP5/6Bone remodeling regulation

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tnfsf11; Opgl; Rankl; Trance; Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD antigen CD254) [Cleaved into: Tumor necrosis factor ligand superfamily member 11; membrane form; Tumor necrosis factor ligand superfamily member 11; soluble form]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Uniprot No.

Target Background

Function
RANKL (receptor activator of nuclear factor kappa-B ligand) is a cytokine that binds to TNFRSF11B/OPG (osteoprotegerin) and TNFRSF11A/RANK (receptor activator of nuclear factor kappa-B). It serves as an osteoclast differentiation and activation factor. RANKL enhances the ability of dendritic cells to stimulate naïve T-cell proliferation. It may play a crucial role in regulating interactions between T-cells and dendritic cells and may contribute to the regulation of the T-cell-dependent immune response. RANKL may also be a significant regulator of increased bone resorption in humoral hypercalcemia of malignancy. RANKL induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells. A key effect is the induction of sustained oscillations in the intracellular concentration of Ca2+, leading to the activation of NFATC1. NFATC1 translocates to the nucleus and induces osteoclast-specific gene transcription, enabling the differentiation of osteoclasts. During osteoclast differentiation, RANKL, in a TMEM64 and ATP2A2-dependent manner, induces activation of CREB1 and mitochondrial ROS generation, essential for proper osteoclast formation.
Gene References Into Functions
  1. Research findings demonstrate that the membrane-bound form of RANKL is sufficient for most of its functions but that the soluble form does contribute to physiological bone remodeling in adult mice. PMID: 30046091
  2. At the molecular level, it was confirmed that RES upregulated FoxO1 transcriptional activity by inhibiting the PI3K/AKT signaling pathway, thereby promoting resistance to oxidative damage and restraining osteoclastogenesis. Inhibition of the PI3K/AKT signaling pathway might be induced by RANKL. PMID: 29115382
  3. Deletion of the RANKL D5 enhancer delays the progression of atherosclerotic plaque development and plaque calcification in hypercholesterolemic mice. PMID: 28419519
  4. These findings suggest that A2BAR stimulation inhibits the activation of ERK1/2, p38, and NF-kappaB by RANKL, which suppresses the induction of osteoclast marker genes, thus contributing to a decrease in osteoclast cell-cell fusion and bone resorption activity. PMID: 29047264
  5. Compressive force induced the differentiation of RAW264.7 cells through an increase in RANK and a decrease in LGR4 expression. PMID: 29572179
  6. miR-145 expression was inhibited in RANKL-induced osteoclastogenesis. PMID: 29577879
  7. LPS increased mRNA and protein expressions of IL-6 and RANKL on day 14. PMID: 28637991
  8. hBD-1 potentiates the induction of in vitro osteoclastogenesis by RANKL through enhanced phosphorylation of the p44/42 MAPKs. PMID: 28709835
  9. In conclusion, these results suggest that linarin exhibits anti-osteoclastic effects and could potentially serve as modulatory agents for the prevention and treatment of bone loss-associated diseases. PMID: 29269297
  10. Rankl(-/-) bone marrow-mesenchymal stromal cells displayed reduced clonogenicity and osteogenic capacity. PMID: 28100034
  11. In this study, the authors identified through gene expression profiling that microgravity induces high levels of TRAIL expression in murine preosteoclast cells in the absence of RANKL stimulation compared to ground-based cultures. PMID: 27142480
  12. Results demonstrate that LOX has the ability to induce RANKL expression on stromal cells; however, it fails to substitute for RANKL in osteoclastogenesis. PMID: 27606829
  13. Results showed that picroside II strongly inhibited RANKL-induced osteoclast formation when added during the early stage of BMMs cultures, suggesting that it acts on osteoclast precursors to inhibit RANKL/RANK signaling. PMID: 28464271
  14. Loss of BMP signaling specifically in osteocytes dramatically increases bone mass, presumably through simultaneous inhibition of RANKL and SOST, leading to osteoclast inhibition and Wnt activation together. PMID: 27402532
  15. The potentiation of RANKL-induced CTX release by dexamethasone was significantly less in bone marrow macrophage cells from mice with conditional knockout of the osteoclastic glucocorticoid receptor and completely absent in cells from GR(dim) mice, which carry a point mutation in one dimerizing interface of the GC receptor. PMID: 27596806
  16. Findings demonstrate that mTORC1 activation-stimulated RANKL expression in B cells is sufficient to induce bone loss and osteoporosis. The study also established a link between mTORC1 and the RANKL/OPG axis via negative regulation of beta-catenin. PMID: 26825871
  17. Dihydroartemisinin inhibited RANKL-induced NF-kappaB and NFAT activity. PMID: 26684711
  18. Cyanidin chloride is capable of inhibiting osteoclast formation, hydroxyapatite resorption, and RANKL-induced signal pathways in vitro and ovariectomy-induced bone loss in vivo. PMID: 28771720
  19. Together these data indicate that osteocyte apoptosis plays a central and controlling role in triggering osteocyte RANKL production and the activation of new resorption leading to bone loss in disuse. PMID: 26852281
  20. Data (including data from studies using knockout mice) suggest that RANKL enhances TNF-induced osteoclast formation from precursor spleen cells and enhances bone resorption independently of Traf6 by degrading Traf3, a known inhibitor of osteoclastogenesis. (RANKL = osteoclast differentiation factor; TNF = tumor necrosis factor; Traf = TNF receptor-associated factor) PMID: 28438834
  21. Results suggest that the MAPK signaling pathway is necessary for receptor activator of nuclear factor kappa-B ligand (RANKL) expression in bone marrow stromal cells. PMID: 28161637
  22. Endocortical resorption is driven by reduced osteoprotegerin rather than elevated RANKL expression. PMID: 27460899
  23. The results showed that AG490 inhibited (p)-JAK2 and RANKL expression. PMID: 28278513
  24. Play a supportive role in the RANKL-dependent differentiation. PMID: 27413168
  25. Increased expression of RANKL in heterogeneous bone marrow cells provoked bone destruction during Group A Streptococcus infection. PMID: 26894505
  26. Beta-lapachone inhibits RANKL-induced osteoclastogenesis and could be considered a potent inhibitor of RANKL-mediated bone diseases. PMID: 27913299
  27. Differentiation by suppressing the Ca2+-calcineurin-NFATc1 signaling pathway. Although many questions remain unresolved, to our knowledge, this is the first report demonstrating that PEMF is beneficial against RANKL-dependent osteoclastic differentiation in RAW264.7 cells in vitro via inhibiting the Ca2+-calcineurin-NFATc1 signaling pathway. PMID: 27856256
  28. These results demonstrate that RANKL expressed by osteocytes is required for the bone loss as well as the increase in B cell number caused by estrogen deficiency. PMID: 27733688
  29. In conclusion, the present study demonstrated that EA can suppress osteoclastogenesis in vitro. Moreover, we clarified that these inhibitory effects of EA occur through suppression of NF-kappaB and ERK activation. Therefore, EA may be a potential agent in the treatment of osteoclast-related diseases such as osteoporosis. PMID: 27349866
  30. MDH1 expression was induced by receptor activator of nuclear factor kappa-B ligand (RANKL) treatment. PMID: 27179783
  31. miR-338-3p may play a significant role in glucocorticoid-induced osteoclast differentiation and function by targeting RANKL in osteoclasts. PMID: 27706599
  32. The protein and RNA levels of RANKLinduced cFos and nuclear factor of activated T-cell cytoplasmic 1 were suppressed by centipedegrass extract (CGE). These results indicated that CGE may serve as a useful drug in the prevention of bone loss. PMID: 27035226
  33. Lipopolysaccharides significantly up-regulated RANKL expression and activated the ERK1/2 pathway to induce IL-6 mRNA expression and protein synthesis in MLO-Y4 cells. PMID: 27778412
  34. This study shows that OPG constitutes an early biomarker in an experimental model of severe malaria. PMID: 26766771
  35. Osteoprotegerin plays a role in preserving myocardial structure and function with aging through a reduction in apoptosis and preservation of the matrix structure. PMID: 26825553
  36. These results indicate that activation of Panx1 and P2X7 R are required for apoptotic osteocytes in fatigued bone to trigger RANKL production in neighboring bystander osteocytes and implicate ATP as an essential signal mediating this process. PMID: 26553756

Show More

Hide All

Database Links
Involvement In Disease
Deficiency in Tnfsf11 results in failure to form lobulo-alveolar mammary structures during pregnancy, resulting in death of newborns. Trance-deficient mice show severe osteopetrosis, with no osteoclasts, marrow spaces, or tooth eruption, and exhibit profound growth retardation at several skeletal sites, including the limbs, skull, and vertebrae and have marked chondrodysplasia, with thick, irregular growth plates and a relative increase in hypertrophic chondrocytes.
Protein Families
Tumor necrosis factor family
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type II membrane protein.; [Isoform 2]: Cell membrane; Single-pass type II membrane protein.; [Isoform 3]: Cytoplasm.; [Tumor necrosis factor ligand superfamily member 11, soluble form]: Secreted.
Tissue Specificity
Highly expressed in thymus and lymph nodes, but not in non-lymphoid tissues and is abundantly expressed in T-cells but not in B-cells. A high level expression is also seen in the trabecular bone and lung.

Q&A

What is Recombinant Mouse Tnfsf11 and what are its alternative names?

Recombinant Mouse Tnfsf11 is a member of the tumor necrosis factor (TNF) family, also commonly known as receptor activator of NF-kappa B ligand (RANK L), TNF-related activation-induced cytokine (TRANCE), osteoprotegrin ligand (OPGL), and osteoclast differentiation factor (ODF). It was originally identified as an immediate early gene upregulated by T cell receptor stimulation. The mouse TRANCE protein is a type II transmembrane protein consisting of 316 amino acids with a cytoplasmic domain of 48 amino acids and an extracellular domain of 247 amino acids. The extracellular domain contains two potential N-linked glycosylation sites .

What are the structural characteristics of commercially available Recombinant Mouse Tnfsf11?

Commercially available Recombinant Mouse Tnfsf11 comes in different forms with specific structural characteristics:

  • E. coli-expressed version (Catalog # 462-TEC):

    • Contains amino acids Lys158-Asp316 with an N-terminal Met

    • Appears as a single band at approximately 19 kDa on SDS-PAGE under reducing conditions

    • Biological activity (ED50) for osteoclast differentiation: 0.5-2 ng/mL

  • Alternative version with His-tag (Catalog # 462-TR):

    • Contains amino acids Arg72-Asp316 with an N-terminal 6-His tag

    • Appears as a single band at approximately 36 kDa on SDS-PAGE under reducing conditions

    • Biological activity (ED50) for osteoclast differentiation: 5-15 ng/mL (requires a cross-linking antibody)

What is the biological function of Tnfsf11 in normal physiology?

Tnfsf11 serves multiple critical functions in normal physiology:

  • Osteoclastogenesis induction: It is a key factor in stimulating the differentiation of osteoclasts, which are essential for bone remodeling and homeostasis

  • T cell growth enhancement: Promotes proliferation and survival of T lymphocytes

  • Dendritic cell function: Improves the function and survival of dendritic cells

  • Lymph node organogenesis: Plays a crucial role in the development and organization of lymph nodes

  • Signal transduction: Activates the c-jun N-terminal kinase pathway

Tnfsf11 primarily targets RANK (receptor activator of NF-kappa B) as its signaling receptor, which undergoes receptor clustering during signal transduction. Its effects are naturally counterbalanced by osteoprotegerin, a soluble member of the TNF receptor family that acts as a decoy receptor .

How should researchers reconstitute and store Recombinant Mouse Tnfsf11 for optimal activity?

Reconstitution Protocol:

For E. coli-expressed version (462-TEC):

  • Reconstitute at 100 μg/mL in sterile PBS

  • If using the carrier-free version (462-TEC/CF), follow the same reconstitution concentration but be aware it lacks BSA stability enhancement

For His-tagged version (462-TR):

  • Reconstitute at 50 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin

Storage Recommendations:

  • Upon receipt, immediately store according to recommended temperature

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity

  • For working solutions, store at 2-8°C for up to one month

  • For long-term storage, prepare aliquots and store at -20°C to -80°C

What are the validated experimental applications for Recombinant Mouse Tnfsf11?

Based on citation evidence from multiple published studies, Recombinant Mouse Tnfsf11 has been successfully employed in the following experimental applications:

  • Osteoclast differentiation assays: Most commonly used with RAW 264.7 mouse monocyte/macrophage cell line to induce osteoclastogenesis

  • Bone metabolism studies: Used in research exploring pathological bone loss, arthritis-induced bone erosion, and cancer cell-mediated osteolysis

  • Immune cell function assays: Applied in research examining T cell and dendritic cell biology

  • Signal transduction analysis: Used to study NF-κB pathway activation and c-jun N-terminal kinase signaling

  • Compound screening: Employed in evaluating the effects of potential therapeutic agents on osteoclast differentiation and function

What is the recommended protocol for inducing osteoclast differentiation using Recombinant Mouse Tnfsf11?

Standard Protocol for Osteoclast Differentiation:

  • Cell Preparation:

    • Culture RAW 264.7 mouse monocyte/macrophage cells in appropriate medium (typically DMEM with 10% FBS)

    • Seed cells at a density of 1-2×10⁴ cells/well in a 96-well plate

  • Tnfsf11 Treatment:

    • For E. coli-expressed rmTRANCE (462-TEC): Add at concentrations of 0.5-2 ng/mL

    • For His-tagged rmTRANCE (462-TR): Add at concentrations of 5-15 ng/mL along with 2.5 μg/mL of a cross-linking antibody (e.g., Mouse Anti-polyHistidine Monoclonal Antibody, Catalog # MAB050)

  • Incubation:

    • Maintain cultures for 4-7 days, with medium changes every 2-3 days if necessary

  • Assessment:

    • Evaluate osteoclast formation through TRAP (Tartrate-resistant acid phosphatase) staining

    • Analyze bone resorption capabilities using appropriate substrates (e.g., dentin slices, calcium phosphate-coated plates)

    • Measure osteoclast-specific gene expression via qPCR (e.g., TRAP, cathepsin K, calcitonin receptor)

What are the key differences between E. coli-expressed and His-tagged versions of Recombinant Mouse Tnfsf11?

ParameterE. coli-expressed (462-TEC)His-tagged (462-TR)
Amino acid coverageLys158-Asp316 with N-terminal MetArg72-Asp316 with N-terminal 6-His tag
Molecular weight~19 kDa~36 kDa
ED50 for osteoclast differentiation0.5-2 ng/mL5-15 ng/mL (requires cross-linking antibody)
Reconstitution concentration100 μg/mL in sterile PBS50 μg/mL in sterile PBS with ≥0.1% albumin
Additional requirementsNoneRequires cross-linking antibody for optimal activity
Glycosylation patternNon-glycosylatedNon-glycosylated

These differences can significantly impact experimental outcomes. The E. coli-expressed version typically shows higher intrinsic activity, while the His-tagged version offers advantages for purification and detection but requires cross-linking for optimal function .

How does carrier-free Tnfsf11 differ from BSA-containing formulations and when should each be used?

Carrier-Free vs. BSA-Containing Formulations:

Carrier-free (CF) versions of Recombinant Mouse Tnfsf11 lack bovine serum albumin (BSA) as a carrier protein, whereas standard formulations include BSA. Understanding these differences is critical for experimental design:

BSA-Containing Formulations:

  • Enhanced protein stability and increased shelf-life

  • Allows for storage at more dilute concentrations

  • Recommended for cell or tissue culture applications and as ELISA standards

  • Formulated in a solution containing NaH₂PO₄, NaCl, and EDTA with BSA as a carrier protein

Carrier-Free Formulations:

  • Lacks BSA in the formulation

  • Recommended for applications where BSA might interfere with experimental outcomes

  • Particularly useful for antibody production, protein conjugation, and certain sensitive detection methods

  • Essential for experiments where background BSA could complicate data interpretation

  • Formulated in a solution containing NaH₂PO₄, NaCl, and EDTA without BSA

What signaling pathways are activated by Tnfsf11 and how can researchers monitor these pathways?

Tnfsf11 activates several key signaling pathways through its receptor RANK:

  • NF-κB Pathway:

    • Primary pathway activated by RANK-RANKL interaction

    • Monitor through:

      • IκB phosphorylation and degradation via Western blot

      • Nuclear translocation of NF-κB p65 using immunofluorescence

      • NF-κB-dependent gene expression via reporter assays or qPCR of target genes

  • c-Jun N-terminal Kinase (JNK) Pathway:

    • Important for osteoclast differentiation

    • Monitor through:

      • JNK phosphorylation via Western blot

      • c-Jun phosphorylation and activity

      • AP-1 transcription factor activation using EMSA or reporter assays

  • p38 MAPK Pathway:

    • Contributes to osteoclast formation and activity

    • Monitor through p38 phosphorylation and downstream target activation

  • ERK Pathway:

    • Involved in osteoclast survival

    • Monitor through ERK1/2 phosphorylation and target gene induction

  • Calcium Signaling:

    • Critical for osteoclast cytoskeletal reorganization

    • Monitor using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators

What are common issues encountered when using Recombinant Mouse Tnfsf11 and how can they be resolved?

Issue 1: Reduced or absent biological activity

  • Potential causes:

    • Protein denaturation from improper storage or handling

    • Insufficient reconstitution

    • Missing cross-linking antibody (for His-tagged version)

  • Solutions:

    • Ensure proper reconstitution following manufacturer's protocol

    • Add cross-linking antibody (2.5 μg/mL) when using His-tagged Tnfsf11

    • Avoid freeze-thaw cycles; use fresh aliquots

    • Verify protein integrity via SDS-PAGE before use

Issue 2: Variation in osteoclastogenesis efficiency

  • Potential causes:

    • Cell passage number affecting RAW 264.7 responsiveness

    • Batch-to-batch variation in recombinant protein

    • Suboptimal cell density

  • Solutions:

    • Use lower passage RAW 264.7 cells (under passage 20)

    • Optimize cell seeding density for each experimental setup

    • Include positive controls to normalize between experiments

    • Consider titrating Tnfsf11 concentration for each new lot

Issue 3: Interfering factors in complex experimental systems

  • Potential causes:

    • Presence of osteoprotegerin (OPG) in culture systems

    • Competing cytokines affecting results

  • Solutions:

    • Test for OPG expression in your experimental system

    • Consider using OPG-neutralizing antibodies if necessary

    • Use carrier-free Tnfsf11 when studying interactions with other proteins

    • Implement appropriate controls for cytokine studies

How can researchers optimize Tnfsf11-induced osteoclastogenesis for specific experimental questions?

For Enhanced Osteoclast Formation:

  • Supplement with M-CSF (25-50 ng/mL) alongside Tnfsf11 for primary monocyte/macrophage cultures

  • Pre-treat cells with vitamin D3 (10⁻⁸ M) to upregulate RANK expression

  • Optimize the cell density: higher density for RAW 264.7 cells (1-2×10⁴ cells/well) and lower density for primary bone marrow macrophages (5×10³ cells/well)

  • Use E. coli-expressed Tnfsf11 (462-TEC) which requires lower concentrations for activity

  • Extend culture duration to 7-10 days for more mature osteoclasts with enhanced resorptive capacity

For Studying Inhibitory Compounds:

  • Use submaximal concentrations of Tnfsf11 (0.5-1 ng/mL for E. coli-expressed; 5-7 ng/mL for His-tagged)

  • Consider timing of inhibitor addition (pre-treatment vs. co-treatment)

  • Include appropriate vehicle controls for compounds dissolved in DMSO or ethanol

  • Assess both osteoclast number and individual osteoclast activity

  • Implement dose-response analysis for inhibitory compounds

What factors influence the reproducibility of Tnfsf11-dependent experiments?

Several factors can significantly affect the reproducibility of experiments using Recombinant Mouse Tnfsf11:

  • Protein stability and storage:

    • Aliquot reconstituted protein to minimize freeze-thaw cycles

    • Store according to manufacturer recommendations

    • Use within the recommended time period after reconstitution

  • Cell line characteristics:

    • Cell passage number influences responsiveness to Tnfsf11

    • Clone-specific variation in RAW 264.7 cells

    • Donor variation when using primary cells

  • Experimental design considerations:

    • Consistent seeding density is critical

    • Timing of Tnfsf11 addition after seeding

    • Medium composition and serum batch effects

    • Presence of endogenous OPG in experimental system

  • Technical variables:

    • Pipetting accuracy when working with low concentrations

    • Consistent culture conditions (CO₂, humidity, temperature)

    • Method of assessment (TRAP staining protocol, imaging parameters)

How does mouse Tnfsf11 compare to human TNFSF11 in structure and function?

Structural Similarities and Differences:

  • Both are type II transmembrane proteins

  • Both contain TNF homology domains in the extracellular region

  • Mouse Tnfsf11 is 316 amino acids while human is slightly different in length

  • N-glycosylation sites are largely conserved between species

  • Species-specific differences exist in the intracellular domain

Functional Considerations:

  • Both activate the same primary signaling pathways

  • Cross-reactivity exists but is not complete; mouse Tnfsf11 may have reduced activity on human cells and vice versa

  • Similar roles in osteoclastogenesis, though potency may differ

  • Species-specific differences in expression patterns across tissues

  • Differential sensitivity to certain inhibitors and therapeutic agents

These comparisons are particularly important when designing translational studies or interpreting results from mouse models for human disease applications.

What are the emerging research areas involving Tnfsf11 beyond osteoclastogenesis?

While Tnfsf11 is best known for its role in osteoclast differentiation, research has expanded into several other significant areas:

  • Immune System Regulation:

    • T cell development and function

    • Dendritic cell survival and activation

    • Lymph node development and organization

    • Interactions with other immune cell types

  • Cancer Biology:

    • Promotion of cancer cell-mediated osteolysis in bone metastasis

    • Direct effects on cancer cell proliferation and survival

    • Immunomodulatory effects in the tumor microenvironment

    • Potential therapeutic target in cancer-induced bone disease

  • Metabolic Regulation:

    • Role in glucose metabolism

    • Influence on energy expenditure

    • Connections to obesity and metabolic syndrome

    • Glutamine-dependent energy metabolism in inflammatory conditions

  • Cardiovascular Research:

    • Vascular calcification processes

    • Atherosclerotic plaque stability

    • Cardiac remodeling after injury

  • Neurological Applications:

    • Neuroinflammatory processes

    • Microglial activation

    • Potential roles in neurodegenerative diseases

How can researchers effectively use Tnfsf11 in drug development and screening applications?

Recombinant Mouse Tnfsf11 serves as a valuable tool in drug development and screening, particularly for compounds targeting bone metabolism disorders:

Methodological Approaches:

  • High-Throughput Screening Systems:

    • Establish standardized osteoclastogenesis assays using RAW 264.7 cells in 96- or 384-well formats

    • Implement automated TRAP staining and quantification

    • Use calcium phosphate-coated plates for simultaneous assessment of resorption activity

    • Develop reporter cell lines expressing osteoclast-specific promoters linked to luciferase

  • Target Validation Strategies:

    • Compare effects on Tnfsf11-induced vs. alternative osteoclastogenesis pathways

    • Assess compound effects on different stages of osteoclast differentiation by varying treatment timing

    • Combine with genetic approaches (siRNA, CRISPR) targeting RANK pathway components

  • Translational Model Systems:

    • Progress from in vitro RAW 264.7 screens to primary mouse bone marrow macrophages

    • Implement ex vivo bone organ culture systems as an intermediate step

    • Validate promising compounds in appropriate in vivo models

  • Mechanistic Investigations:

    • Determine whether compounds directly interfere with Tnfsf11-RANK interaction

    • Assess effects on downstream signaling pathways using phospho-specific antibodies

    • Evaluate effects on specific osteoclast genes and proteins

    • Consider off-target effects on other TNF family members

What are the newest methodological approaches for studying Tnfsf11 biology?

Recent advances in research technology have opened new avenues for studying Tnfsf11 biology with unprecedented precision:

  • CRISPR/Cas9 Genome Editing:

    • Generation of cell lines with modified RANK or downstream signaling components

    • Creation of reporter systems with endogenous tagging of Tnfsf11 pathway proteins

    • Development of conditional knockout systems for temporal control of Tnfsf11/RANK expression

  • Advanced Imaging Techniques:

    • Live-cell imaging of Tnfsf11-RANK interactions using fluorescently tagged proteins

    • Super-resolution microscopy to visualize receptor clustering dynamics

    • Intravital imaging to monitor osteoclast formation and activity in vivo

  • Single-Cell Analysis:

    • Single-cell RNA sequencing to identify heterogeneity in responses to Tnfsf11

    • CyTOF and spectral flow cytometry for high-dimensional protein analysis

    • Spatial transcriptomics to map Tnfsf11 signaling in tissue context

  • Computational Approaches:

    • Systems biology modeling of Tnfsf11 signaling networks

    • Machine learning algorithms to predict compound effects on Tnfsf11-induced pathways

    • Bioinformatic integration of multi-omics data to identify novel regulatory mechanisms

How might Tnfsf11 research contribute to understanding and treating metabolic bone disorders?

Tnfsf11 research has significant implications for understanding and developing treatments for metabolic bone disorders:

  • Osteoporosis:

    • Denosumab, a human monoclonal antibody against RANKL, demonstrates the clinical relevance of this pathway

    • Mouse models using recombinant Tnfsf11 help identify novel therapeutic targets

    • Understanding the regulation of endogenous Tnfsf11 expression can reveal new intervention points

  • Rheumatoid Arthritis:

    • Tnfsf11 contributes to inflammatory bone erosion

    • Targeting TRPC channels in Tnfsf11-mediated arthritis-induced bone erosion represents a novel approach

    • Combination therapies addressing both inflammation and Tnfsf11-induced bone loss

  • Cancer-Induced Bone Disease:

    • Understanding how cancer cells modulate the Tnfsf11 pathway

    • Developing strategies to inhibit cancer cell-mediated osteolysis

    • Potential for combined anti-tumor and bone-protective therapies

  • Novel Therapeutic Approaches:

    • Bispecific antibodies targeting Tnfsf11 and inflammatory cytokines

    • Small molecule inhibitors of downstream signaling components

    • Anabolic agents that counter Tnfsf11 effects

    • Natural compounds like Zingerone and Artemisinin-Daumone hybrids showing promise in Tnfsf11-induced osteoclastogenesis inhibition

What quality control measures should researchers implement when working with recombinant Tnfsf11?

To ensure experimental reliability when working with Recombinant Mouse Tnfsf11, researchers should implement comprehensive quality control measures:

  • Protein Verification:

    • Confirm protein integrity via SDS-PAGE analysis before use

    • Verify bioactivity using a standardized osteoclastogenesis assay

    • Consider implementing a minimum activity threshold for experimental use

  • Experimental Controls:

    • Include positive controls (known osteoclastogenic factors) in each experiment

    • Use negative controls (no Tnfsf11 treatment) to establish baseline

    • Consider including inhibitor controls (OPG or anti-RANKL antibody)

  • Reproducibility Measures:

    • Document lot numbers and source of recombinant protein

    • Standardize cell culture conditions and passage numbers

    • Implement consistent protocols for reconstitution and storage

    • Conduct regular testing of frozen aliquots for activity maintenance

  • Advanced Validation:

    • Periodically verify protein by mass spectrometry

    • Test for endotoxin contamination that could confound inflammatory responses

    • Compare activity across different commercial sources or in-house preparations

    • Consider orthogonal assays to confirm specific Tnfsf11-dependent effects

These quality control measures are essential for maintaining experimental consistency and ensuring reliable research outcomes when working with this critical signaling protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.