Recombinant Mouse Tumor necrosis factor ligand superfamily member 6 (Faslg)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant Mouse Faslg Variants

Product CodeExpression SystemTagMolecular Weight (Theoretical/Observed)Cross-Linking Requirement
6128-SA Mammalian cellsHemagglutinin18 kDa / 26–32 kDaAnti-HA Antibody
526-SA Mouse myeloma NSO cells6xHis18 kDa / 28–32 kDaAnti-His Antibody
F0552 NSO cells6xHis + CD3318 kDa / 28–32 kDaAnti-His Antibody

Biological Activity

Recombinant Faslg requires cross-linking antibodies (e.g., anti-His or anti-HA) to trimerize and activate Fas receptors effectively . Key functional data include:

  • Apoptosis Induction: Effective at 0.4–8 ng/mL in Jurkat cells or primary lymphocytes .

  • Dual Signaling:

    • Pro-Apoptotic: Binds Fas/CD95, triggering caspase-8 activation via the Death-Inducing Signaling Complex (DISC) .

    • Pro-Inflammatory: In TGF-β-deficient environments, promotes neutrophil chemotaxis and inflammation .

Nerve Repair and Schwann Cell Regulation

  • Knockdown vs. Overexpression:

    • Faslg siRNA increases Schwann cell (SC) proliferation and migration while reducing apoptosis .

    • Faslg overexpression suppresses SC proliferation and enhances apoptosis via caspase-3 and NF-κB pathways .

Table 2: Faslg Modulation in Schwann Cells

ParameterFaslg KnockdownFaslg Overexpression
Proliferation (EdU)↑ 1.8-fold↓ 60%
Migration↑ 2.5-fold↓ 70%
Apoptosis Rate↓ 40%↑ 2.2-fold
Key Pathways↓ Caspase-3, ↓ NF-κB↑ Caspase-3, ↑ NF-κB

Immune Regulation and Disease

  • Autoimmunity: Gld mice with Faslg mutations develop lymphoproliferation and systemic autoimmunity .

  • Cancer Immune Evasion: Tumors upregulate Faslg to kill infiltrating T cells, mimicking immune checkpoint mechanisms .

Applications in Research

  1. Apoptosis Assays: Used to study Fas/Faslg interactions in T-cell tolerance and activation-induced cell death .

  2. Inflammation Models: Investigates neutrophil recruitment in sterile inflammation .

  3. Cancer Biology: Explores Faslg’s role in tumor immune evasion .

Key References

  1. R&D Systems, 6128-SA Datasheet .

  2. Frontiers in Molecular Neuroscience, 2018 (Schwann cell study) .

  3. Sigma-Aldrich, F0552 Technical Bulletin .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Faslg; Apt1lg1; Cd95l; Fasl; gld; Tnfsf6; Tumor necrosis factor ligand superfamily member 6; CD95 ligand; CD95-L; Fas antigen ligand; Fas ligand; FasL; CD antigen CD178
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
Uniprot No.

Target Background

Function

Fas ligand (FasL) is a cytokine that binds to TNFRSF6/FAS, a receptor mediating apoptotic signaling in cells. It plays a crucial role in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis, and T-cell development. FasL initiates activation-induced cell death (AICD) in antigen-activated T-cells, contributing to immune response termination and peripheral tolerance induction. It also binds to the decoy receptor TNFRSF6B/DcR3, which inhibits apoptosis. Furthermore, FasL induces FAS-mediated NF-κB activation, triggering non-apoptotic signaling pathways. While capable of inducing apoptosis, it's not essential for this process. Its cytoplasmic form inhibits gene transcription.

Gene References Into Functions
  1. Autosomal Dominant Polycystic Kidney Disease patients with moderately preserved renal function have higher levels of FasL, myostatin, and urinary TGF-β1 than controls. PMID: 29794429
  2. miR181a negatively regulates BMMSC-induced CD4+ T lymphocyte apoptosis by modulating FasL protein expression in BMMSCs, potentially a key mechanism in estrogen deficiency-induced osteoporosis. PMID: 29845202
  3. Platelet-derived FasL contributes to apoptosis in stroke. PMID: 27608763
  4. Increased FasR and/or FasL expression correlates with disease progression. Spherical cancer cell models may be more reliable for certain analyses due to their greater resemblance to cancer stem cells. PMID: 28766682
  5. FAS-FASL promoter SNPs may increase cross-reactive anti-ganglioside antibody production in Guillain-Barré syndrome. PMID: 29432441
  6. Dysregulation of the Fas/FasL system occurs in an experimental animal model of HELLP syndrome. PMID: 28501275
  7. Vitamin D may alleviate pathological changes, reduce Fas/FasL expression, and attenuate myocardial cell apoptosis in diabetic cardiomyopathy rats. PMID: 28595623
  8. Serum sFasL may indicate apoptotic thyroid state and predict the clinical course of Graves' disease. PMID: 28276714
  9. CNS macrophage-derived CD95L directs coordinated neurovascular development. PMID: 28514658
  10. FasL gene polymorphisms in peripheral blood may accurately detect cellular acute rejection after pediatric renal transplantation. PMID: 27109035
  11. CD3+ CD8+ NKG2D+ T lymphocytes induce apoptosis and necroptosis in HLA-negative cells via FasL-Fas interaction. PMID: 28294381
  12. The -844T/C polymorphism in the FasL gene is associated with hepatocellular carcinoma risk in Egyptian patients. PMID: 26891954
  13. Anti-FasL treatment prevents lymphocyte apoptosis, upregulates type-1 responses to *Trypanosoma cruzi* antigens, and reduces infection in macrophages cocultured with activated CD8 T cells. PMID: 27195678
  14. CD95 mediates leukocyte slow rolling, adhesion, and transmigration upon binding of CD95L presented by endothelial cells. PMID: 27763263
  15. FasL receptor interaction activates the Tag7-Hsp70 complex, with FasL acting as a receptor inducing intracellular signaling. MicA stress ligand-NKG2D receptor interaction is needed for cytotoxic complex release. PMID: 27868339
  16. Adeno-associated virus-mediated gene delivery of soluble FasL provides sustained neuroprotection in glaucoma models. PMID: 27849168
  17. Propofol anesthesia activates Fas/FasL-mediated extrinsic and Bcl-2-dependent intrinsic apoptotic pathways, leading to caspase activation, microglia activation, and persistent hyperactivity. PMID: 27189477
  18. Neutrophil-dependent FasL expression by iNKT cells restricts autoantibody production during inflammasome-driven inflammation. PMID: 27798616
  19. Increased FasL expression on peripheral B-1 cells in filarial patients correlates with apoptotic T-helper cells, suggesting a role in immune anergy. PMID: 28208221
  20. LRH-1 is expressed in T cells, regulates FASLG transcription, and its inhibition may treat FasL-mediated immunopathologies. PMID: 28406481
  21. CD95L stimulates proliferation during normal small intestine turnover but has a minimal effect on intestinal homeostasis. PMID: 26700225
  22. CD95, FasL, and FADD expression is low during embryonic development but increases rapidly. PMID: 27561622
  23. FasL rs763110 C/T polymorphism increases rheumatoid arthritis risk in Caucasians. PMID: 26905515
  24. FASL gene polymorphism and serum levels are associated with autoimmune thyroid diseases. PMID: 27458112
  25. miR-98 modulates apoptosis and is downregulated in myocarditis patients, potentially interacting with the FAS/FASL gene pair. PMID: 27323110
  26. Fas -670 GG, FasL -844 TC, and CC genotypes increase chronic myeloid leukemia risk. PMID: 26563376
  27. Different FasL expression in placentas from idiopathic intrauterine growth retardation (IUGR) and IUGR + pre-eclampsia suggests distinct roles in these syndromes. PMID: 25909501
  28. Increased FasL expression contributes to immune evasion in non-small cell lung carcinomas. PMID: 26823709
  29. Fas/FasL signaling and SOCS1 promote high glucose-induced mitochondrial dysfunction and apoptosis in diabetic retinopathy. PMID: 26700587
  30. The FASL -844 T/C polymorphism is associated with systemic lupus erythematosus susceptibility. PMID: 27050822
  31. TIM4 increases apoptotic colon cancer cells and FasL expression. PMID: 26921445
  32. FAS or FASL gene knockout may attenuate isoflurane-induced caspase-3 increase. PMID: 26609525
  33. In dermal fibroblasts, THy1/β3 integrin-induced apoptosis is mediated by FasL upregulation. PMID: 26967483
  34. Faim2/LFG protects against FasL-induced apoptosis by downregulating ER calcium release in cortical neurons. PMID: 26582200
  35. FasL, MSH2, ABCC5, CASP3, and CYP3A4 associate with progression-free survival in osteosarcoma patients. PMID: 25829401
  36. Deficient Fas ligand regulation, such as by the IL-12 signaling pathway, may cause autoimmune lymphoproliferative syndrome-like disease. PMID: 26113417
  37. No significant association exists between FasL SNPs and papillary thyroid cancer development. PMID: 25824544
  38. CD8+ T cells and FasL protect against *Plasmodium yoelii* NL infection. PMID: 25760084
  39. c-REL deficiency, but not NF-κB2 deficiency, prevents autoimmune disease driven by FasL mutation. PMID: 25361085
  40. FasL genetic polymorphism is associated with rheumatoid arthritis (meta-analysis). PMID: 25645050
  41. Membrane-bound FasL mediates platelet-induced apoptosis; Bax/Bak signaling reinforces this process. PMID: 26232171
  42. Estrogen preserves FasL protein accumulation by inhibiting miR-181a expression, maintaining bone remodeling balance. PMID: 26062603
  43. Cumulus cells surrounding aging oocytes release sFasL, accelerating oocyte aging via Fas receptor binding. PMID: 25731893
  44. The FASL -844C>T polymorphism may reduce gynecological cancer risk. PMID: 25661359
  45. The protective effect of the FASL CC genotype suggests similar biomolecular mechanisms involving FASL in female-specific cancers. PMID: 25472583
  46. Biliary tree stem/progenitor cells modulate T cell response via FasL, inducing apoptosis in CD4+ and CD8+ T cells. PMID: 24953023
  47. Pharmacological CD95L inhibition dampens peripheral innate response, reduces myeloid cell accumulation, and prevents MPTP-induced neuronal death. PMID: 25779632
  48. The Fas A670G polymorphism increases preeclampsia risk, while FasLG IVS2nt 124 A>G may be protective. PMID: 24951049
  49. Fas ligand expression on cardiomyocytes makes cardiac allografts resistant to CD4+ T-cell mediated rejection. PMID: 25497973
  50. Deficient FasL reverse signaling may contribute to the lymphoproliferative phenotype of ALPS. PMID: 25451160
Database Links

KEGG: mmu:14103

STRING: 10090.ENSMUSP00000000834

UniGene: Mm.3355

Involvement In Disease
A deficiency in this protein is the cause of generalized lymphoproliferation disease phenotype (gld). Gld mice present lymphadenopathy and autoantibody production. The phenotype is recessively inherited.
Protein Families
Tumor necrosis factor family
Subcellular Location
[Isoform FasL]: Cell membrane; Single-pass type II membrane protein. Cytoplasmic vesicle lumen. Lysosome lumen.; [Tumor necrosis factor ligand superfamily member 6, soluble form]: Secreted.; [FasL intracellular domain]: Nucleus.
Tissue Specificity
Expressed in T-cells. Expressed in natural killer cells.

Q&A

What is Recombinant Mouse Fas Ligand/TNFSF6 and what are its key biological functions?

Fas Ligand (FasL), also known as CD178, CD95L, or TNFSF6, is a 40 kDa type II transmembrane protein belonging to the TNF superfamily. Its primary function is inducing apoptosis in cells expressing its receptor, Fas (CD95). This interaction plays crucial roles in:

  • Development, homeostasis, and function of the immune system

  • Maintaining immune tolerance and self-tolerance of lymphocytes

  • Establishing immune privilege in certain tissues

  • Limiting lymphoid expansion via lymphoid-lymphoid interactions

The mature mouse FasL consists of a 179 amino acid extracellular domain (ECD), a 22 amino acid transmembrane segment, and a 78 amino acid cytoplasmic domain. Within the ECD, mouse FasL shares 81% and 93% amino acid sequence identity with human and rat FasL, respectively .

What are the structural variants of Recombinant Mouse FasL and how do they differ functionally?

Different recombinant forms of mouse FasL are available for research, each with distinct structural characteristics and functional properties:

Catalog NumberStructural FeaturesFunctional PropertiesActivity Range
6128-SAContains hemagglutinin tag, GCN4-IZ, (GGGS)3 linker, and mouse FasL (Gln101-Leu279)Forms stable homotrimers, exhibits enhanced cytotoxic activity1-8 ng/mL (with 2.5 μg/mL cross-linking antibody)
526-SAContains Pro132-Leu279 with N-terminal Met and 6-His tagWeak cytotoxic activity, no effect on A20 mouse B cell lymphoma cells0.25-1.5 μg/mL (with 10 μg/mL cross-linking antibody)

The trimerization domain in the 6128-SA variant allows for more stable formation of the homotrimer and increased biological activity compared to other forms .

How do membrane-bound and soluble forms of FasL differ in their biological activities?

Membrane-bound and soluble FasL exhibit significant differences in their biological activities:

  • Membrane-bound FasL:

    • Primary activator of Fas receptor

    • Potent inducer of apoptosis

    • Expressed predominantly on activated T cells and NK cells

  • Soluble FasL (sFasL):

    • Generated by metalloproteinase cleavage of membrane-bound FasL

    • Exists primarily as a non-covalently linked homotrimer

    • Significantly reduced cytotoxicity compared to membrane-bound form

    • May competitively inhibit the killing effect of membrane FasL

    • Functions as a chemoattractant for neutrophils, suggesting a proinflammatory role

These functional differences must be considered when designing experiments to study FasL-mediated processes.

What methodologies are most effective for assessing FasL-induced apoptosis in experimental systems?

To effectively measure FasL-induced apoptosis, researchers should employ multiple complementary techniques:

  • Cell viability assays:

    • MTT or WST-1 assays for metabolic activity

    • Trypan blue exclusion for membrane integrity

  • Apoptosis-specific assays:

    • Annexin V/PI staining and flow cytometry to distinguish early/late apoptosis

    • TUNEL assay for DNA fragmentation

    • Caspase activity assays (particularly caspase-3, -8, and -9)

    • DNA ladder analysis by gel electrophoresis

  • Positive controls and validation:

    • Include a known apoptosis inducer (e.g., staurosporine)

    • Confirm with multiple methodologies

    • Use Fas-expressing cell lines (e.g., Jurkat T cells)

For recombinant FasL (Catalog # 6128-SA), the ED50 for cytotoxic effect is 1-8 ng/mL when used with 2.5 μg/mL of a cross-linking antibody (Mouse Anti-Hemagglutinin/HA Peptide Monoclonal Antibody) .

How can researchers optimize cross-linking strategies to enhance soluble FasL activity?

Cross-linking is critical for enhancing the activity of soluble recombinant FasL:

  • Antibody cross-linking:

    • For hemagglutinin-tagged FasL (6128-SA): Use anti-HA antibody at 2.5 μg/mL with FasL at 1-8 ng/mL

    • For His-tagged FasL (526-SA): Use anti-polyHistidine antibody at 10 μg/mL with FasL at 0.25-1.5 μg/mL

  • Pre-incubation approach:

    • Mix FasL with cross-linking antibody

    • Incubate at room temperature for 15-30 minutes before adding to cells

    • Maintain consistent antibody:FasL ratio across experiments

  • Secondary cross-linking:

    • For enhanced activity, consider using protein G or secondary antibodies

    • This creates larger complexes that more effectively mimic membrane-bound FasL

  • Time course optimization:

    • Determine optimal incubation times (typically 6-24 hours)

    • Monitor apoptosis at multiple timepoints to capture peak activity

What are the key considerations for using Recombinant Mouse FasL in studies of immune privilege?

When investigating immune privilege using recombinant FasL, researchers should consider:

  • Tissue-specific expression patterns:

    • FasL is naturally expressed in immune-privileged sites (e.g., eye, testes, brain)

    • These tissues protect themselves by killing infiltrating Fas-positive lymphocytes

  • Experimental design considerations:

    • Include appropriate controls for FasL specificity (e.g., FasL-deficient tissues)

    • Validate with FasL-blocking antibodies

    • Consider the presence of decoy receptors like DcR3 that can interfere with FasL-induced apoptosis

  • Dual nature of FasL function:

    • While FasL can protect tissues from immune assault via lymphocyte apoptosis

    • It can also damage Fas-expressing tissues

    • In the absence of TGF-beta, FasL/Fas interactions may promote neutrophil-mediated inflammatory responses

This dual "privilege and peril" nature of FasL must be accounted for in experimental designs .

How can mouse models with FasL mutations inform our understanding of FasL function?

Mouse models with FasL mutations provide valuable insights into FasL biology:

  • gld (generalized lymphoproliferative disease) mice:

    • Carry a point mutation in FasL gene

    • Exhibit severe lymphoproliferation and systemic autoimmunity

    • Serve as models for human autoimmune lymphoproliferative syndrome (ALPS)

    • Show the importance of FasL in preventing autoimmunity

  • Experimental approaches using these models:

    • Cell transfer experiments to determine tissue-specific effects

    • Bone marrow chimeras to distinguish hematopoietic vs. non-hematopoietic roles

    • Conditional knockout strategies for temporal control of FasL expression

  • Research applications:

    • Study FasL role in tumor immunity

    • Investigate autoimmune pathogenesis

    • Develop transplantation tolerance approaches

How can Recombinant Mouse FasL be used to investigate cancer biology and potential therapeutic approaches?

FasL plays complex roles in cancer biology that can be investigated using recombinant proteins:

  • Tumor immune evasion:

    • Tumor cells can upregulate FasL to induce apoptosis in tumor-infiltrating lymphocytes

    • This "counterattack" mechanism helps tumors evade immune surveillance

    • Can be studied using co-culture systems with recombinant FasL as control

  • Experimental applications:

    • Use recombinant FasL to mimic tumor microenvironment

    • Study differential sensitivity of immune cell subsets to FasL-induced apoptosis

    • Test FasL-blocking strategies to enhance anti-tumor immunity

  • Therapeutic implications:

    • Blockade of Fas signaling in breast cancer cells suppresses tumor growth and metastasis via disruption of cancer-related inflammation

    • In experimental models, manipulating the FasL/Fas axis influences metastatic potential

Research has demonstrated that blocking Fas signaling can disrupt cancer-related inflammation, suggesting potential therapeutic approaches targeting this pathway .

What are the optimal storage and handling conditions for maintaining Recombinant Mouse FasL activity?

To maintain optimal activity of Recombinant Mouse FasL:

  • Storage recommendations:

    • Store lyophilized protein at -20°C to -80°C

    • After reconstitution, aliquot and store at -80°C (avoid repeated freeze-thaw cycles)

    • Working solutions should be prepared fresh

  • Reconstitution guidelines:

    • Use sterile, buffer-appropriate solutions (typically PBS with 0.1% BSA)

    • Allow protein to equilibrate to room temperature before reconstitution

    • Gently agitate; avoid vortexing to prevent protein denaturation

  • Quality control:

    • Verify activity with cytotoxicity assays before conducting critical experiments

    • Include negative controls (e.g., heat-inactivated FasL)

What cell types and experimental models are most appropriate for studying FasL function?

Select appropriate models based on research objectives:

  • Cell lines for in vitro studies:

    • A20 mouse B cell lymphoma cells express mouse Fas but show variable sensitivity

    • Jurkat T cells are highly sensitive to FasL-induced apoptosis

    • L929 fibroblasts transfected with Fas can be used for specificity studies

  • Primary cells:

    • Activated T cells express both Fas and FasL

    • Neutrophils for studying chemotactic responses

    • Hepatocytes for tissue damage models

  • Animal models:

    • Wild-type mice for normal physiological studies

    • gld mice to study consequences of FasL mutation

    • Conditional knockout models for tissue-specific effects

How can researchers troubleshoot variable or unexpected results when working with Recombinant Mouse FasL?

When encountering variable results:

  • Common issues and solutions:

    • Insufficient cross-linking: Optimize antibody concentration and pre-incubation time

    • Target cell resistance: Verify Fas expression on target cells

    • Loss of activity: Minimize freeze-thaw cycles, prepare fresh working solutions

  • Experimental controls:

    • Include positive controls (known FasL-sensitive cells)

    • Include negative controls (FasL-resistant cells or blocking antibodies)

    • Validate with multiple apoptosis detection methods

  • Technical considerations:

    • Ensure consistent cell density and culture conditions

    • Account for passage number of cell lines

    • Validate protein activity before critical experiments

By implementing these troubleshooting strategies, researchers can enhance the reliability and reproducibility of their FasL experiments.

How does FasL contribute to immune system homeostasis and autoimmunity?

FasL plays essential roles in immune regulation:

  • Lymphocyte homeostasis:

    • Limits lymphoid expansion through lymphoid-lymphoid interactions

    • Contributes to activation-induced cell death (AICD) of T cells

    • Maintains self-tolerance by eliminating autoreactive lymphocytes

  • Autoimmune pathogenesis:

    • Defects in FasL (as in gld mice) cause severe lymphoproliferation and systemic autoimmunity

    • These models mirror human autoimmune lymphoproliferative syndrome

    • Recombinant FasL can be used to study these processes in vitro

  • Research applications:

    • Using recombinant FasL to study T cell apoptosis sensitivity

    • Investigating the role of FasL in regulatory T cell function

    • Developing therapeutic approaches for autoimmune diseases

What role does FasL play in neutrophil recruitment and inflammatory responses?

Beyond its apoptotic function, FasL exhibits important proinflammatory activities:

  • Neutrophil recruitment:

    • Soluble FasL functions as a potent chemoattractant for neutrophils

    • In the absence of TGF-beta, FasL/Fas interactions promote neutrophil-mediated inflammatory responses

  • Inflammation regulation:

    • Paradoxically, FasL can both promote and limit inflammation

    • Membrane-bound versus soluble forms have different inflammatory effects

    • Neutrophils play unexpected roles in clearing apoptotic cells, as demonstrated in hepatocyte models

  • Experimental approaches:

    • Neutrophil migration assays with recombinant FasL

    • In vivo models of inflammation with FasL administration

    • Analysis of neutrophil-mediated tissue damage versus repair

How can researchers utilize Recombinant Mouse FasL to study sex differences in disease susceptibility?

Recent research highlights important sex differences in FasL biology:

  • Sex bias in disease processes:

    • The innate immune system and TRAIL-BCL-XL axis mediate sex bias in lung cancer

    • FasL-related pathways confer differential therapeutic vulnerability in females versus males

  • Experimental design considerations:

    • Include both male and female models in research

    • Analyze sex-specific responses to FasL-induced apoptosis

    • Consider hormonal influences on FasL expression and signaling

  • Research applications:

    • Using recombinant FasL to compare apoptotic sensitivity between male and female cells

    • Investigating sex-specific therapeutic approaches targeting the FasL/Fas pathway

    • Developing personalized medicine approaches based on sex differences in FasL signaling

By incorporating these considerations into experimental design, researchers can better understand how FasL contributes to sex differences in disease susceptibility and treatment responses.

What are emerging applications for Recombinant Mouse FasL in tissue engineering and regenerative medicine?

Emerging research suggests potential applications for FasL in regenerative medicine:

  • Immune-privileged grafts:

    • Engineering tissues to express FasL may protect transplants from immune rejection

    • Creating localized immune privilege without systemic immunosuppression

    • Balancing immune evasion with the risk of inflammatory responses

  • Tissue remodeling:

    • Controlled apoptosis via FasL for tissue sculpting during regeneration

    • Regulating stem cell populations through selective apoptosis

  • Research approaches:

    • Testing FasL-expressing biomaterials in transplantation models

    • Developing controlled-release systems for recombinant FasL

    • Investigating combination approaches with immunomodulatory factors

These applications require careful consideration of FasL's dual roles in immune privilege and inflammation .

How might advances in protein engineering enhance the utility of Recombinant Mouse FasL for research?

Protein engineering offers opportunities to create improved FasL variants:

  • Enhanced stability variants:

    • Engineered disulfide bonds for improved thermal stability

    • Modified trimeric forms with enhanced half-life

    • Domain-specific modifications to preserve specific functions

  • Activity-tuned variants:

    • Selective agonists that preferentially activate specific Fas-mediated pathways

    • Variants with tunable apoptotic versus inflammatory activities

    • Tissue-targeted FasL through fusion with tissue-specific binding domains

  • Detection-optimized variants:

    • Fluorescent fusion proteins for tracking FasL distribution and binding

    • Split reporter systems to monitor FasL-Fas interactions in real-time

    • Affinity-tagged variants for simplified purification and detection

These engineered proteins would provide researchers with more precise tools for investigating FasL biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.