Recombinant Mouse Tumor necrosis factor ligand superfamily member 8 (Tnfsf8)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Recombinant Mouse Tnfsf8 binds to CD30 (TNFRSF8), a receptor expressed on activated lymphocytes and Hodgkin-Reed-Sternberg cells. Key roles include:

  • T-Cell Modulation: Co-stimulates Th0/Th2 proliferation and cytokine secretion (e.g., IL-6, IL-13) .

  • Apoptosis Regulation: Mediates thymic negative selection of CD4+CD8+ T cells .

  • Lymphoma Interaction: Promotes survival and proliferation of Hodgkin’s disease-derived cell lines (EC50: 5–30 ng/mL with cross-linking antibodies) .

Mechanistic Insights

  • Elevated CD153 (Tnfsf8) on aged T follicular helper (Tfh) cells enhances residual Tfh function, linking it to age-related immune dysregulation .

  • Soluble CD30-Tnfsf8 complexes inhibit normal CD30 signaling, suggesting therapeutic potential in autoimmune diseases .

Production and Quality Control

Expression and Purification

  • Tags: His tag (N-terminal), Fc chimera, or carrier-free formats .

  • Storage: Lyophilized protein stable for 6–12 months at -20℃ to -70℃; reconstituted aliquots stable for 1 month at 2–8℃ .

Validation Assays

  • Bioactivity: HDLM cell line IL-6 secretion assay (ND50: 3–10 µg/mL for neutralizing antibodies) .

  • Functional Applications:

    • T-cell costimulation assays

    • Apoptosis studies in thymocytes

    • Lymphoma cell proliferation models

Research Applications

ApplicationKey FindingsReferences
Immune AgingCD153+ Tfh cells drive sustained antibody responses in aged mice
Vaccine DevelopmentActs as a mucosal vaccine adjuvant by enhancing antigen-specific IgA production
Lymphoma TherapeuticsPromotes Hodgkin’s lymphoma cell survival via NF-κB activation
Autoimmunity StudiesSoluble CD30-Tnfsf8 complexes reduce graft-versus-host disease severity in models

Recent Advancements

  • Senotherapeutic Potential: CD153-targeting vaccines reduce senescent T-cell accumulation in aged mice, improving immune function .

  • Structural Insights: Mutational studies (e.g., K78A, R125A variants) map critical residues for CD30 binding .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tnfsf8; Cd30l; Cd30lg; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-239
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
Uniprot No.

Target Background

Function
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Gene References Into Functions
  1. Altered expression of CD30L and IL-3 may be potential biomarkers for hepatotoxicity induced by D. bulbifera. PMID: 24647110
  2. It is shown that CD30L knock out (KO) mice are highly susceptible to primary infection with Listeria monocytogenes, as assessed by the survival rate. PMID: 21699557
  3. Modulation of CD30L/CD30 signaling by soluble CD30 could be a novel biological therapy for inflammatory diseases associated with Th17 responses. PMID: 21068411
  4. Characterization of the murine CD30 ligand (CD153) gene: gene structure and expression. PMID: 12392508
  5. CD30L is required for the generation of long-lived memory CD8+ T cells; CD30L signaling triggers homing receptors for T(central memory) cells. PMID: 16177108
  6. Signaling executed by CD30-positive T cell interaction with CD30L-positive T cells plays a critical role in the amplification of T helper type (Th)1 responses capable of producing interferon-gamma against Mycobacterium bovis bacillus Calmette-Guerin infection. PMID: 18941223

Show More

Hide All

Database Links

KEGG: mmu:21949

STRING: 10090.ENSMUSP00000030047

UniGene: Mm.4664

Protein Families
Tumor necrosis factor family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is mouse Tnfsf8 and how does it differ from its human ortholog?

Mouse Tnfsf8, also known as CD30L or CD153, is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. It functions as the specific ligand for the receptor TNFRSF8/CD30. The protein is a type II membrane protein expressed on various immune cells and is critical for immune regulation in mice .

Mouse Tnfsf8 spans amino acids Gln68-Asp239 in the mature protein (Accession #P32972) with a molecular weight of approximately 22 kDa. While the core functions are conserved between species, mouse and human Tnfsf8 have distinct expression patterns and show minor structural differences that can affect their binding affinities and downstream signaling intensity .

What are the alternative names for mouse Tnfsf8 in scientific literature?

In scientific publications, mouse Tnfsf8 may be referenced under several alternative designations:

  • CD153

  • CD30L (CD30 Ligand)

  • CD30LG

  • TNLG3A

Understanding these alternative nomenclatures is essential when conducting comprehensive literature searches to avoid missing relevant research findings .

What cells naturally express mouse Tnfsf8 and under what conditions?

Mouse Tnfsf8 expression occurs on:

  • Activated T cells, B cells, and monocytes (inducible expression)

  • Granulocytes and medullary thymic epithelial cells (constitutive expression)

  • Neutrophils (constitutive expression)

Expression is typically upregulated during immune activation and inflammatory responses. In experimental settings, stimulation with various cytokines and immune activators can induce Tnfsf8 expression in cultured lymphocytes, making timing of cell collection critical in experimental design .

How can recombinant mouse Tnfsf8 be effectively reconstituted for experimental use?

Recombinant mouse Tnfsf8 is typically supplied as a lyophilized powder that requires proper reconstitution to maintain biological activity. A methodological approach includes:

  • Reconstitute in sterile PBS to a concentration of 100-500 μg/mL

  • Allow complete solubilization by gentle rotation for 30-60 minutes at room temperature

  • For long-term storage, prepare small aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted protein at -20°C to -70°C for up to 3 months or at 2-8°C for up to 1 month under sterile conditions

Critical consideration: The biological activity of reconstituted Tnfsf8 should be verified before use in cellular assays, particularly after prolonged storage, as protein aggregation can diminish functionality.

What functional assays can verify the biological activity of recombinant mouse Tnfsf8?

The biological activity of recombinant mouse Tnfsf8 can be assessed through several validated assays:

  • IL-6 secretion assay: Measure IL-6 production in HDLM human Hodgkin's lymphoma cells following Tnfsf8 stimulation. For optimal results, use 500 ng/mL of recombinant mouse Tnfsf8 in conjunction with 10 μg/mL of a cross-linking antibody (e.g., Mouse polyHistidine Monoclonal Antibody) .

  • T-cell proliferation assay: Quantify the proliferative response of isolated murine T cells when exposed to varying concentrations of Tnfsf8 using techniques such as tritiated thymidine incorporation or CFSE dilution .

  • Binding assay: Demonstrate specific binding to CD30/TNFRSF8 using flow cytometry or surface plasmon resonance techniques to confirm receptor-ligand interaction .

A significant limitation is that cross-species reactivity may vary, requiring careful validation when using mouse Tnfsf8 in human cell systems.

How can researchers effectively neutralize mouse Tnfsf8 activity in experimental systems?

For neutralization experiments, researchers can employ:

  • Specific neutralizing antibodies: Anti-mouse CD30L/TNFSF8 antibodies can block the interaction between Tnfsf8 and its receptor. Typical neutralization assays require 3-10 μg/mL of neutralizing antibody to inhibit the activity of 500 ng/mL recombinant mouse Tnfsf8 .

  • Soluble receptor competition: Recombinant soluble CD30/TNFRSF8 can sequester Tnfsf8 and prevent cellular signaling.

  • Genetic approaches: CRISPR/Cas9-mediated knockout or siRNA knockdown of Tnfsf8 in experimental animals or cell lines.

When designing neutralization experiments, titration of neutralizing agents is critical as incomplete neutralization can lead to residual activity and misinterpretation of results.

How does mouse Tnfsf8 contribute to neutrophil function and inflammation?

Mouse Tnfsf8 plays a significant role in neutrophil biology through several mechanisms:

  • Constitutive expression: Unlike other immune cells that require activation for Tnfsf8 expression, neutrophils constitutively express this molecule .

  • Activation pathway: Cross-linking of CD30L on neutrophils induces:

    • IL-8 production

    • Rapid oxidative burst

    • Neutrophil activation

  • Genetic association: TNFSF8 polymorphisms have been associated with differences in peripheral neutrophil counts. Specifically, the rs927374 polymorphism shows a significant association where GG homozygotes demonstrate approximately 16% lower neutrophil counts compared to CC homozygotes (7.6±5.1 vs. 9.0±5.2) .

These findings suggest an autoregulatory role for Tnfsf8 in neutrophil homeostasis and function, with potential implications for inflammatory disease models.

What is the role of mouse Tnfsf8 in lymphoma research models?

Mouse Tnfsf8 has pleiotropic effects on lymphoma cells, making it valuable for cancer research:

  • Proliferative effects: In some lymphoma cell lines, Tnfsf8 enhances cell proliferation.

  • Cytotoxic effects: In other lymphoma cell lines, Tnfsf8 induces cell death and reduces proliferation.

  • Hodgkin lymphoma relevance: The Tnfsf8 receptor (CD30) is a characteristic marker for Hodgkin's and Reed-Sternberg cells, making this ligand-receptor system critical in understanding lymphoma biology .

How can mouse Tnfsf8 be utilized in immune modulation studies?

Tnfsf8 offers several approaches for immune modulation research:

  • T-cell costimulation: Tnfsf8 induces proliferation of T-cells, making it useful for studying T-cell activation and expansion protocols .

  • B-cell function: The engagement of Tnfsf8 on B-cell surfaces plays an inhibitory role in modulating immunoglobulin class switching, allowing for targeted manipulation of antibody responses .

  • Inflammation models: Given its role in neutrophil activation and association with neutrophil counts, Tnfsf8 manipulation can be valuable in studying inflammatory conditions and outcomes .

When designing immune modulation studies, researchers should consider the context-dependent effects of Tnfsf8, as its impact may vary based on the cellular environment and concurrent signaling pathways.

How do genetic variations in mouse Tnfsf8 affect experimental outcomes across different mouse strains?

Genetic polymorphisms in Tnfsf8 can significantly influence experimental results:

Research has identified that specific TNFSF8 polymorphisms (rs927374 and rs2295800) are associated with differences in peripheral neutrophil counts, with these SNPs demonstrating high linkage disequilibrium (r²=0.97) . This genetic variation should be considered when:

  • Selecting mouse strains: Different inbred mouse strains may carry different Tnfsf8 alleles, potentially affecting baseline neutrophil counts and inflammatory responses.

  • Interpreting cross-strain experiments: Phenotypic differences observed between mouse strains in inflammation models may partially result from Tnfsf8 variations rather than the experimental intervention.

  • Developing congenic lines: Researchers interested in isolating Tnfsf8 effects might consider developing congenic lines that differ only in the Tnfsf8 locus.

A methodological approach to address this variation includes genotyping experimental animals for known Tnfsf8 polymorphisms and stratifying results accordingly to reduce unexplained variability.

What are the technical challenges in producing functional recombinant mouse Tnfsf8?

Production of biologically active recombinant mouse Tnfsf8 faces several challenges:

How can researchers effectively analyze the complex signaling network downstream of Tnfsf8-CD30 interaction?

Analyzing the Tnfsf8-CD30 signaling network requires integrative approaches:

  • Protein interaction network: STRING analysis reveals that Tnfsf8 has significant interactions with multiple TNFR family members beyond its primary receptor CD30/TNFRSF8, including TNFRSF4, CD27, and others with interaction scores ranging from 0.829 to 0.999 .

  • Phosphoproteomic approach: Temporal analysis of phosphorylation events following CD30 stimulation can map the signaling cascade, with particular attention to NF-κB pathway components.

  • Transcriptomic analysis: RNA-seq at various timepoints after Tnfsf8 stimulation can reveal the dynamic changes in gene expression and identify novel downstream targets.

  • Systems biology integration: Combining these datasets with computational modeling can help predict and validate key nodes in the signaling network.

This multifaceted approach provides a comprehensive understanding of how Tnfsf8 signaling integrates with other immune pathways and identifies potential points for therapeutic intervention.

What are emerging areas for mouse Tnfsf8 research in immune-oncology?

Several promising research directions for Tnfsf8 in immune-oncology include:

  • Immunotherapy combinations: Investigating how Tnfsf8-CD30 interactions might complement checkpoint inhibitor therapies by examining the effects of recombinant Tnfsf8 on tumor-infiltrating lymphocyte activity.

  • CAR-T cell enhancement: Exploring whether engineered expression of Tnfsf8 on CAR-T cells might improve their proliferation, persistence, and anti-tumor activity, particularly for CD30+ lymphomas.

  • Biomarker development: Investigating whether soluble Tnfsf8 levels correlate with treatment response or disease progression in lymphoma models.

These approaches require careful consideration of the dual nature of Tnfsf8 signaling, which can promote either proliferation or apoptosis depending on the cellular context .

How can high-throughput screening approaches identify novel modulators of Tnfsf8 signaling?

Systematic screening for Tnfsf8 pathway modulators can employ:

  • CRISPR-Cas9 screens: Genome-wide or targeted CRISPR screens in CD30-expressing cells can identify genes that enhance or suppress Tnfsf8-mediated signaling.

  • Small molecule libraries: Screening compound libraries for molecules that modulate Tnfsf8-CD30 binding or downstream signaling, using reporter cell lines that express fluorescent or luminescent proteins under the control of NF-κB response elements.

  • Protein engineering: Directed evolution approaches to generate Tnfsf8 variants with enhanced receptor selectivity or altered signaling properties.

The integration of these high-throughput approaches with detailed mechanistic validation can accelerate the discovery of tools for precise manipulation of Tnfsf8 signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.