Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Response

CD40 mediates critical immune functions through interactions with CD40L (TNFSF5):

RoleMechanismExperimental Evidence
B Cell ActivationCostimulates B cell proliferation, differentiation, and antibody class switching
Dendritic Cell MaturationInduces maturation and antigen presentation via TRAF6-dependent pathways
Cytokine ProductionTriggers GM-CSF, MCP-1, and TNF-α secretion in renal carcinoma cells
Tumor ImmunologyEnhances leukocyte recruitment (DCs, T cells) and inhibits tumor growth

Research Applications and Therapeutic Potential

Recombinant CD40 is utilized in diverse experimental and clinical contexts:

ApplicationDetailsSource
Cancer ImmunotherapyCD40 stimulation on renal carcinoma cells induces MCP-1/GM-CSF, recruiting immune cells and reducing metastases
Autoimmune DiseaseTargeting CD40-CD40L interaction may prevent transplant rejection or autoimmune pathology
Cardiovascular ResearchImplicated in atherosclerosis; recombinant CD40 aids in studying endothelial cell interactions

In Vitro Studies

  • Cytokine Induction: Stimulation of CD40+ renal carcinoma cells (Renca) with anti-CD40 antibodies induces GM-CSF (up to 200 pg/mL) and MCP-1 (dose-dependent) .

  • Protein Expression: Recombinant CD40 (24–193 aa) in HEK 293 cells shows >95% purity and <1 EU/μg endotoxin .

In Vivo Studies

  • Tumor Regression: CD40 stimulation in Renca-bearing mice increases splenocyte count, DC subsets, and serum TNF-α, inhibiting tumor progression .

  • Species-Specific Effects: Human CD40 antibodies reduce pulmonary metastases in SCID mice with ACHN renal carcinoma .

Key Research Challenges and Considerations

  • Structural Variability: Soluble isoforms and post-translational modifications complicate molecular weight analysis .

  • Therapeutic Risks: Blocking CD40-CD40L may cause vascular complications, necessitating non-competitive antagonist strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All protein shipments are standardly provided with blue ice packs. If you require dry ice, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize its development.
Synonyms
Cd40; Tnfrsf5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CD antigen CD40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-289
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV
Uniprot No.

Target Background

Function
CD40, a receptor for TNFSF5/CD40LG, plays a crucial role in immune regulation. It transduces TRAF6- and MAP3K8-mediated signals, activating ERK in macrophages and B cells, ultimately leading to the induction of immunoglobulin secretion.
Gene References Into Functions
  1. These studies highlight a PPARgamma-dependent miR-424/503-CD40 signaling axis that is vital for regulating inflammation-mediated angiogenesis. PMID: 28566713
  2. Data indicate a CD40-dependent mechanism capable of negating receptor-related orphan gammat(+) (RORgammat(+)) Helios(-)-induced Treg (iTreg) cell induction by CD103(+) dendritic cells (DCs). PMID: 28276457
  3. While either BCR or CD40 ligation induced c-Myc in naive B cells, both signals were required to significantly induce c-Myc, a critical factor in GC B cell survival and cell cycle reentry. PMID: 29396161
  4. These findings suggest that CD40-activated CD40L reverse signaling has notable and contrasting effects on the growth and elaboration of dendrites among major classes of brain neurons via PKC-dependent mechanisms. PMID: 29111976
  5. Results suggest that platelet CD40 plays a pivotal role in neointima formation following arterial injury. PMID: 29037856
  6. CD73 expression identifies a subset of IgM(+) antigen-experienced cells with memory attributes that are T cell and CD40 signaling dependent. PMID: 28746783
  7. CD40 silencing with a specific siRNA ameliorates progression of experimental atherosclerosis in ApoE(-/-) mice via the NF-kappaB/miR-125b signaling axis. PMID: 27835742
  8. CD40 functions as a non-redundant mechanism in immunologically converting the tumor microenvironment. PMID: 27292635
  9. CD40 plays a critical role in the pathogenesis of type 1 diabetes, influencing lymphocyte trafficking, T-cell receptor expression, and T-cell pathogenesis. PMID: 28542921
  10. Role with b7 in primary germinal center generation of distinct antigen-presenting cells. PMID: 28768709
  11. CD40 signaling in adipose tissue macrophages regulates major histocompatibility complex class II and CD86 expression to control the expansion of CD4(+) T cells. PMID: 26658005
  12. Adoptively transferred Th40 cells (CD4+CD40+ Tcells) are present in CNS lesions and are associated with widespread demyelination. PMID: 28192476
  13. This study reports that anti-CD40 mAb administration <3 d in advance of chemotherapy is lethal in more than half of treated C57BL/6 mice in a pancreatic cancer model. PMID: 27217585
  14. The data show that CD40-mediated inhibition of PC generation occurs through the engagement of multiple pathways and constitutive CD40 signaling in vivo involving bystander T-B interactions can modulate B cell differentiation outcomes. PMID: 27342845
  15. BAFF upregulates CD28/B7 and CD40/CD154 expression, and promotes the interactions between T and B cells in a BAFF-R-dependent manner. PMID: 27180986
  16. CD40 in Muller cells is sufficient to upregulate retinal inflammatory markers and appears to promote experimental diabetic retinopathy. Muller cells orchestrate inflammatory responses in myeloid cells through a CD40-ATP-P2X7 pathway. PMID: 27474370
  17. Collectively, our data demonstrate the importance of CD40 signaling in the conversion of CTL exhaustion and its ability to enhance PD-1 antagonist action in rescuing exhausted CTLs in chronic infection. PMID: 28153727
  18. Upon miR-155 overexpression, Cd40 expression was significantly upregulated with a negative correlation to the miR-155 primary target Ship1 expression in mice. PMID: 27509492
  19. These results suggest that Il23a expression in DCs is synergistically triggered by the PG E2-EP4-cAMP-PKA pathway and canonical/non-canonical NF-kappaB pathways and CREB activated by CD40 stimulation. PMID: 26189370
  20. Results suggest that altered CD40 signaling and granulocyte recruitment in response to infection are responsible for the Ity5-associated Salmonella susceptibility of A/J mice. PMID: 26562079
  21. Our findings highlight novel roles for CD40 and cysteine-238-mediated CD40 homodimers in cell biology and identify a potential new target for therapeutic strategies against CD40-associated chronic inflammatory diseases. PMID: 25977307
  22. Latent virus infection upregulates CD40 expression, facilitating enhanced autoimmunity in a model of multiple sclerosis. PMID: 26356194
  23. Platelet CD40 plays a crucial role in inflammation by stimulating leukocyte activation and recruitment, and activation of endothelial cells, thereby promoting atherosclerosis. PMID: 26821950
  24. There is significant involvement of the CD40-CD40L signaling pathway in long-term brain dysfunction in an animal model of sepsis. PMID: 25822797
  25. NIK, and likely the noncanonical NF-kappaB pathway, is critical for enabling DCs to acquire the capacity to cross-present antigen and prime CD8 T cells after exposure to licensing stimuli. PMID: 26561586
  26. The C57-CD40L(-/-) mouse is a useful surrogate model of X-HIGM syndrome for studying immune responses elicited against pathogens. PMID: 26064940
  27. While treated CD40 knockout mice remained healed, developed long-term immunity, and were resistant to secondary Leishmania major challenge, treated CD40L knockout reactivated their lesion after cessation of rIL-12 treatment. PMID: 26304989
  28. Anti-OX40L mAb could prolong secondary heart allograft survival based on CD40/CD40L and LFA-1/ICAM-1 blockade. PMID: 25613092
  29. CD40 on lymph node fibroblasts facilitated bidirectional communication with CD4(+) T cells via CD40-CD40L, thereby altering fibroblast gene expression of immune regulatory molecules. PMID: 25856408
  30. CD40L mediates neointima formation via its classic receptor CD40 rather than through its recently described novel interaction with Mac-1. PMID: 24652469
  31. p62 regulates CD40-mediated NF-kappaB activation in macrophages through interaction with TRAF6. PMID: 26133577
  32. Although LIGHT is critical for maintaining primary Th1 response, it is dispensable during secondary anti-Leishmania immunity in the presence of functional CD40 signaling. PMID: 26026056
  33. Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein alpha (SIRPalpha) antagonists that enhance antibody-dependent cellular phagocytosis. PMID: 25837251
  34. Findings indicate that in a setting of acute hepatitis, tumor-induced hepatic myeloid-derived suppressor cells act as proinflammatory immune effector cells capable of killing hepatocytes in a CD40-dependent manner. PMID: 25616156
  35. These data reveal the L. major-enhanced CD40-induced N-Ras activation as a novel immune evasion strategy and the potential for Ras isoform-targeted antileishmanial immunotherapy and immunoprophylaxis. PMID: 25786685
  36. Data indicate a role of scaffold protein JLP in bridging CD40 antigen internalization and CD40-dependent signaling in B lymphocytes. PMID: 25586186
  37. CD40 is required for protective immunity against liver stage Plasmodium infection. PMID: 25646303
  38. Demonstrates that the simultaneous silencing of CD40 and CD80 genes has synergistic effects in preventing allograft rejection, suggesting potential therapeutic applications in clinical transplantation. PMID: 24886282
  39. An SHP-1-centered feedback system wherein SHP-1 modulates CD40-induced p38MAPK activation threshold and reciprocal ERK-1/2 activation, establishing itself as a critical regulator of CD40 signaling reciprocity. PMID: 25187664
  40. Results imply that any setting of T cell lymphopenia or reduced CD40 function, including B cell recovery following transplantation, will impact the naive B cell repertoire. PMID: 25172502
  41. These results indicate that CD40 plays distinct roles in different tissues and, unexpectedly, plays an important role in maintaining immune homeostasis in epididymal adipose tissue. PMID: 24647739
  42. CD40 signaling activates naive B cells to a phenotype that is intermediate between the naive and plasma cell stages of B cell differentiation. PMID: 24482285
  43. Gammadelta T cells might activate dendritic cells via CD40 signaling during infection. Dendritic cell activation via gammadelta T cells expressing CD40 ligand is critical during the early phase of infection with Plasmodium berghei XAT. PMID: 24815981
  44. We present the surprising finding that CD40 deficiency on T cells aggravates whereas activation of CD40 signaling improves adipose tissue inflammation and its metabolic complications. PMID: 24664276
  45. Fas signals act as a silencing mechanism for CD40-induced RAGs and prevent CD40 translocation to the nucleus. PMID: 24037181
  46. Data indicate that CD40-CD154 interactions drive the functional activation of steady-state dendritic cells. PMID: 24420080
  47. Data indicate that CD40 stimulation enhanced only TLR-9 expression. PMID: 24387292
  48. Data suggest that simultaneous knock-down of CD40 and IL-23p19 production by bone marrow-derived DCs (BMDCs) may represent a therapeutic tool for the treatment of IL-17-dependent autoimmune diseases, including multiple sclerosis. PMID: 24387596
  49. CD40 plays a crucial role as an important costimulatory molecule in experimental autoimmune neuritis. PMID: 24709684
  50. The CD40/CD40L-assisted crosstalk between mesenchymal stromal cells and mast cells in the splenic marginal zone lymphoma (SMZL) microenvironment finds correlation in p53(-/-) mice developing SMZL. PMID: 24452203

Show More

Hide All

Database Links
Subcellular Location
[Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform III]: Cell membrane; Single-pass type I membrane protein.; [Isoform IV]: Cell membrane; Single-pass type I membrane protein.; [Isoform V]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted.

Q&A

What is CD40 and what is its significance in immunology research?

CD40 is a 48 kD type I transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNFR) superfamily. It serves as a critical costimulatory molecule for the activation of B cells, dendritic cells, monocytes, and other antigen-presenting cells. CD40 plays essential roles in multiple immunological processes including Ig isotype switching, dendritic cell maturation, and the activation, differentiation and proliferation of B cells. It also interacts with TNFR2 and functions in the regulation of signal transduction pathways . The biological significance of CD40 extends beyond normal immune function, making it an important research target for understanding immune disorders, cancer immunotherapy approaches, and neurodegenerative conditions like Alzheimer's disease .

How does recombinant mouse CD40 differ from native mouse CD40?

Recombinant mouse CD40 is typically produced as a fusion protein (often with an Fc tag) in expression systems such as NS0 cells to ensure proper folding and post-translational modifications. While the core protein structure remains consistent with native CD40, recombinant versions may include additional elements like fusion tags that can affect protein solubility, half-life, and in some cases, biological activity. High-quality recombinant mouse CD40 preparations maintain >90% purity as determined by SDS-PAGE and silver staining, with endotoxin levels below 0.1 EU/μg to ensure experimental reliability . The biological activity of recombinant mouse CD40 is specifically validated through functional assays measuring its ability to inhibit rmCD40 ligand-induced B cell proliferation, with typical ED50 values ranging from 0.1-0.3 μg/ml in the presence of 100 ng/ml recombinant mouse CD40 ligand .

What is the CD40-CD154 signaling axis and why is it important?

The CD40-CD154 (CD40L) signaling axis represents a crucial costimulatory pathway in the immune system. CD40 interacts with its ligand CD154 (a 39 kD protein) to trigger multiple downstream signaling events that are essential for adaptive immunity. This interaction is particularly important for:

  • B cell activation, proliferation, and differentiation

  • Antibody class switching

  • Germinal center formation

  • Dendritic cell maturation and activation

  • T cell-dependent humoral responses

Therapeutically, blocking the interaction of CD40 with CD154 has emerged as an important objective for preventing and/or improving both autoimmune diseases and transplant rejection . Additionally, the CD40-CD154 interaction has been identified as essential for amyloid-beta-induced microglial activation, thus playing a significant role in Alzheimer's disease pathogenesis .

How can researchers track CD40 signaling during germinal center development?

Tracking CD40 signaling during germinal center (GC) development requires sophisticated molecular approaches that assess pathway activation. Research has revealed that despite the requirement of CD40 signaling for GC formation, the signaling itself is not consistently active throughout GC development. Investigators can track CD40 signaling through:

  • Gene expression signature analysis: By inducing CD40 signaling in transformed GC B cells in vitro and identifying a CD40 gene expression signature using DNA microarray analysis. This signature can then be investigated in the gene expression profiles of normal B cells .

  • Tracking nuclear factor-κB (NF-κB) translocation: Upon CD40 stimulation, NF-κB transcription factors translocate from the cytoplasm to the nucleus. Immunohistochemical or imaging approaches that detect this translocation can serve as visual indicators of active CD40 signaling .

  • Continuous binary scoring methods: These quantitative approaches measure the extent to which genes that are up-regulated or down-regulated in CD40-untreated cells compared to treated cells show the same differential expression trend across different cell populations. The scoring system incorporates normalized differences in average expression between cell types, providing statistical significance to the observed patterns .

Research using these approaches has surprisingly revealed that the CD40 signature is present in pre- and post-GC B cells (naive and memory) but not in GC B cells themselves, suggesting that GC expansion occurs largely in the absence of CD40 signaling, which may act primarily in the initial and final stages of the GC reaction .

What are the key considerations when designing experiments to measure CD40-mediated B cell activation?

When designing experiments to measure CD40-mediated B cell activation, researchers should consider:

  • Appropriate positive and negative controls: Include CD40 ligand stimulation as positive control and isotype-matched controls for antibody experiments.

  • Dose-response relationships: The biological activity of mouse CD40 shows a specific dose-dependent relationship, with ED50 values typically in the range of 0.1-0.3 μg/ml when in the presence of 100 ng/ml recombinant mouse CD40 ligand .

  • Readout selection: Various parameters can indicate B cell activation:

    • Proliferation assays (thymidine incorporation or flow cytometry-based)

    • Surface activation marker expression (CD69, CD80, CD86)

    • Cytokine/chemokine production

    • Antibody class switching

  • Temporal considerations: CD40 signaling effects vary over time:

    • Early activation markers appear within hours

    • Proliferation peaks at 48-72 hours

    • Antibody production and class switching require longer timeframes

  • Cell purity and viability: Ensure B cells are properly isolated and maintain high viability (>90%) prior to experiments.

  • Endotoxin contamination: Recombinant proteins should have endotoxin levels <0.1 EU/μg to prevent non-specific activation .

What are the optimal conditions for using recombinant mouse CD40 in in vitro research models?

The optimal conditions for using recombinant mouse CD40 in in vitro research depend on the specific experimental goals. For inhibition studies of CD40-CD154 interactions, researchers should consider:

Storage and Handling:

  • Store lyophilized protein at -20°C to -80°C

  • Reconstitute in sterile buffer without carrier protein for maximum flexibility

  • Allow protein to equilibrate to room temperature before reconstitution

  • Once reconstituted, prepare aliquots to avoid freeze-thaw cycles

Experimental Parameters:

  • Concentration range: For inhibition studies, typically 0.1-0.3 μg/ml of recombinant mouse CD40 effectively inhibits B cell proliferation induced by 100 ng/ml recombinant mouse CD40 ligand

  • Medium composition: Serum can affect protein activity; consider testing both serum-containing and serum-free conditions

  • Incubation time: Varies based on experimental endpoint (24-96 hours)

  • Temperature: Standard cell culture conditions (37°C, 5% CO2)

Quality Control:

  • Verify protein activity using established bioassays

  • Confirm low endotoxin levels (<0.1 EU/μg) to prevent non-specific immune activation

  • Check purity (>90% by SDS-PAGE with silver stain)

How can researchers effectively measure the biological activity of recombinant mouse CD40?

The biological activity of recombinant mouse CD40 can be reliably measured through several complementary approaches:

  • B Cell Proliferation Inhibition Assay: The standard method determines CD40's ability to inhibit recombinant mouse CD40 ligand-induced B cell proliferation. The expected ED50 for this effect typically ranges from 0.1-0.3 μg/ml when tested in the presence of 100 ng/ml recombinant mouse CD40 ligand .

  • Competitive Binding Assays: These assess the ability of recombinant CD40 to compete with cell-surface CD40 for binding to CD154.

  • Downstream Signaling Analysis: Measuring activation of NF-κB pathway components or other signaling molecules like JNK and p38 MAPK after CD40-CD154 interaction.

  • Flow Cytometry-Based Competition Assays: Using fluorescently labeled CD154 to quantify the inhibition of binding to cell-surface CD40 in the presence of recombinant mouse CD40.

  • Reporter Cell Lines: Engineered cell lines expressing CD40-responsive elements driving reporter gene expression can provide a quantitative readout of functional activity.

Assay TypeKey ParametersExpected ResultsAdvantages
B Cell Proliferation Inhibition0.1-0.3 μg/ml CD40, 100 ng/ml CD40LDose-dependent inhibition of B cell proliferationPhysiologically relevant functional readout
Flow Cytometry Competition0.1-10 μg/ml CD40, labeled CD40LReduction in cell-surface binding of labeled CD40LDirect measurement of binding competition
NF-κB Reporter Assay0.5-5 μg/ml CD40Reduced activation of reporter geneSpecific pathway activation assessment

How should researchers interpret contradictory findings in CD40 signaling studies?

Contradictory findings in CD40 signaling studies are not uncommon and require careful analysis. When encountering contradictory results, researchers should consider:

  • Cell Type and Context Specificity: CD40 signaling pathways and outcomes differ significantly between cell types. For instance, the CD40 signaling patterns observed in B cells differ from those in dendritic cells or monocytes. Research has shown that CD40 gene expression signatures are present in naive and memory B cells but notably absent in germinal center B cells, highlighting the context-dependent nature of CD40 signaling .

  • Experimental Model Variations: Different mouse strains, primary cells versus cell lines, and in vitro versus in vivo studies can yield different results. The presence or absence of cofactors in the experimental system can significantly impact CD40 signaling outcomes.

  • Temporal Dynamics: CD40 signaling is not static but changes over time. Studies on germinal center development suggest that CD40 signaling may be critical during the initial and final stages of the germinal center reaction rather than during the expansion phase .

  • Reagent Considerations: Different forms of recombinant CD40 (soluble versus membrane-bound, tagged versus untagged) and various anti-CD40 antibodies (agonistic versus antagonistic) can produce divergent results.

  • Pathway Crosstalk: CD40 signaling interacts with multiple other pathways. For example, CD40 interacts with TNFR2 in the regulation of signal transduction , which may lead to different experimental outcomes depending on the status of these interacting pathways.

To resolve contradictions, researchers should implement:

  • Stringent biological replicates and statistical analysis

  • Multiple complementary techniques to examine the same biological question

  • Careful consideration of positive and negative controls

  • Detailed reporting of experimental conditions

  • Use of gene expression patterns and NF-κB localization as objective markers of CD40 pathway activation

What are the key biomarkers for evaluating CD40-targeted therapeutic interventions?

When evaluating CD40-targeted therapeutic interventions, researchers should monitor several key biomarkers that reflect pathway modulation and therapeutic efficacy:

  • B Cell Dynamics:

    • Quantitative changes in peripheral blood B cell counts

    • Alterations in CD21 expression, which shows reduced expression following CD40 pathway modulation

    • B cell activation markers (CD80, CD86)

    • Antibody production and class switching

  • NK Cell Parameters:

    • Changes in NK cell numbers, which typically show transient reductions

    • Increased CD54 expression, observed at higher doses of CD40-targeted agents

  • Cytokine/Chemokine Profile:

    • MIP-1β and IL12 plasma concentrations, which rise after effective CD40 modulation

    • TNF-α, IL-6, and other inflammatory cytokines

  • NF-κB Pathway Activation:

    • Nuclear translocation of NF-κB subunits in target cells

    • Expression of NF-κB-dependent genes

  • Safety Biomarkers:

    • Liver transaminase levels, as elevation may indicate dose-limiting toxicity

    • Inflammatory markers (CRP, ESR)

    • Monitoring for cytokine release syndrome

In clinical applications, doses of 200 mg × 4 (approximately 2.1-3.3 mg/kg based on patient body weight) of agonistic anti-CD40 antibodies have been established as the maximum tolerated dose, with liver transaminase elevations occurring at higher doses (240 mg) . At therapeutic doses, trough levels above 25 μg/mL have been documented before treatment, providing a pharmacokinetic biomarker for monitoring .

How is recombinant mouse CD40 being utilized in immunotherapy research?

Recombinant mouse CD40 and CD40-targeting agents are being extensively investigated in immunotherapy research across several innovative approaches:

  • Cancer Immunotherapy Applications: CD40 has emerged as a promising target for cancer immunotherapy . Researchers are using mouse models with recombinant CD40 to:

    • Enhance dendritic cell-mediated tumor antigen presentation

    • Convert immunosuppressive tumor microenvironments to immunostimulatory ones

    • Combine CD40 agonism with immune checkpoint inhibitors for synergistic effects

    • Study mechanisms of resistance to CD40-based immunotherapies

  • Alternative Approaches to CD40-CD154 Blockade: Since monoclonal antibodies blocking CD154 in human clinical trials resulted in unanticipated vascular complications, there is growing interest in therapeutic antagonist monoclonal antibodies specific for CD40 . Particularly valuable are those that do not inhibit CD40 signaling via physical competition with CD154, but rather through alternative mechanisms.

  • Germinal Center Reaction Modulation: Research reveals that CD40 signaling may be critical only during the initial and final stages of the germinal center reaction . This finding is leading to more precise temporal targeting of CD40 in conditions requiring modulation of antibody responses.

  • Dosing Strategy Optimization: Clinical studies with agonistic anti-CD40 antibodies (like ChiLob7/4) have established biologically effective dose ranges and identified dose-dependent effects including B cell depletion and NK cell modulation . These insights are informing more refined dosing strategies in both preclinical mouse models and clinical applications.

Evidence from clinical studies demonstrates that properly dosed CD40-targeting agents can achieve disease stabilization in treatment-resistant conditions, with some patients maintaining stability for extended periods (median 6 months, longest 37 months) .

What roles does CD40 signaling play in neurodegenerative disease models?

CD40 signaling has emerged as a significant contributor to neuroinflammatory processes in neurodegenerative diseases, particularly in Alzheimer's disease. Research using mouse models has revealed several key mechanisms:

  • Amyloid-beta-Induced Microglial Activation: The interaction between CD40 and its ligand (CD154) has been identified as essential for amyloid-beta-induced microglial activation, playing a significant role in Alzheimer's disease pathogenesis . This discovery positions CD40 signaling as a potential therapeutic target for modulating neuroinflammation.

  • Neuroinflammatory Cascade Regulation: CD40 signaling influences the production of pro-inflammatory cytokines and reactive oxygen species by microglia and astrocytes in response to various pathological triggers. Mouse models with CD40 modulation show altered inflammatory profiles in the central nervous system.

  • Blood-Brain Barrier Integrity: CD40-CD154 interactions affect blood-brain barrier permeability and leukocyte infiltration into the CNS, contributing to disease progression in models of multiple sclerosis and other neuroinflammatory conditions.

  • Synaptic Plasticity and Neuronal Survival: Emerging research suggests that CD40 signaling may directly or indirectly impact synaptic function and neuronal survival, with potential implications for cognitive decline in neurodegenerative disorders.

These findings have stimulated research into CD40-targeted interventions for neurodegenerative conditions, with approaches including:

  • Selective CD40-CD154 interaction inhibitors with CNS penetrance

  • Cell-specific targeting of CD40 signaling in microglia versus peripheral immune cells

  • Temporal modulation of CD40 signaling at different disease stages

  • Combination therapies targeting both amyloid/tau pathology and CD40-mediated neuroinflammation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.