Recombinant Mouse Tumor necrosis factor receptor superfamily member 6 (Fas)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

Mouse Fas (also known as TNFRSF6) is a member of the death receptor subfamily within the tumor necrosis factor receptor superfamily. This receptor protein contains one death domain and three TNFR-Cys repeats, essential structural elements for its functionality in cell signaling . It is widely recognized by multiple synonyms in scientific literature, including Apo-1 antigen, Apoptosis-mediating surface antigen FAS, FASLG receptor, CD95, APO1, APT1, lpr, and TNFR6 .

The recombinant version of Mouse Fas typically encompasses amino acids Gln22-Arg169 of the native protein sequence, which represents the extracellular domain responsible for ligand binding . This specific sequence selection maximizes the protein's biological activity while minimizing potential complications from transmembrane and intracellular domains.

Expression Systems and Manufacturing Process

Recombinant Mouse Fas is predominantly produced using mammalian expression systems, particularly human cell lines, to ensure proper folding, post-translational modifications, and glycosylation patterns that closely mimic the native mouse protein . This approach yields a significantly more biologically relevant protein compared to bacterial expression systems, particularly for complex proteins like Fas that require specific conformational integrity for functional activity.

The manufacturing process typically involves gene cloning, transfection of host cells, protein expression, and multiple purification steps to achieve the high purity levels required for research applications. The recombinant protein is engineered to include fusion tags at either the N-terminus or C-terminus, facilitating both purification and detection in experimental settings .

Fusion Tags and Protein Variants

Several variants of recombinant Mouse Fas are commercially available, differentiated primarily by their fusion tags and formulations. Common fusion tags include:

  1. His tag (6×His): A small, minimally disruptive tag added typically at the C-terminus, resulting in proteins with an apparent molecular mass of 25-35 kDa .

  2. Fc tag: A larger fusion tag derived from immunoglobulin, which increases the apparent molecular mass to approximately 55 kDa but can enhance stability and half-life of the recombinant protein .

Additionally, these proteins are available in carrier-free formulations or with carrier proteins like Bovine Serum Albumin (BSA). The carrier protein enhances stability, increases shelf-life, and allows for storage at more dilute concentrations, making it preferable for cell culture applications and ELISA standards . Carrier-free versions are recommended for applications where the presence of BSA might interfere with experimental outcomes .

Tissue Distribution and Expression

Native Mouse Fas is detected in various tissues throughout the body, including the thymus, liver, lung, heart, and adult ovary . This widespread distribution underlies its fundamental role in cellular homeostasis, particularly in tissues with high cellular turnover rates or those requiring robust immunological surveillance.

Signaling Mechanism and Apoptotic Pathway

Recombinant Mouse Fas functions as a receptor for TNFSF6/FASLG (Fas Ligand), initiating a well-characterized cell death signaling cascade upon ligand binding . The activation mechanism follows several defined steps:

  1. Binding of Fas Ligand (FASLG) to the Fas receptor

  2. Recruitment of the adapter molecule FADD to the activated receptor

  3. Assembly of the death-inducing signaling complex (DISC)

  4. DISC-mediated caspase-8 proteolytic activation

  5. Initiation of the downstream caspase cascade

  6. Execution of programmed cell death (apoptosis)

This apoptotic pathway plays critical roles in multiple physiological processes, including the induction of peripheral tolerance and the antigen-stimulated suicide of mature T-cells . These functions are essential for maintaining immunological homeostasis and preventing autoimmune responses.

Functional Activity in Research Applications

The biological activity of recombinant Mouse Fas can vary depending on the specific preparation and experimental conditions. Some soluble preparations exhibit weak cytotoxic activity independently, while others may require cross-linking antibodies to enhance their effect . For instance, certain preparations demonstrate cytotoxic activity at concentrations of 0.25-1.5 μg/mL when combined with 10 μg/mL of a cross-linking antibody such as anti-polyHistidine monoclonal antibody .

It's noteworthy that the activity profile can differ across cell types. For example, some preparations have been reported to have no effects on A20 mouse B cell lymphoma cells, despite these cells expressing mouse Fas . This differential response highlights the complexity of Fas signaling and the importance of context-dependent factors in determining cellular outcomes.

Formulation and Reconstitution

Recombinant Mouse Fas is typically supplied as a lyophilized powder, formulated from a 0.2 μm filtered solution of PBS at pH 7.4 . The lyophilization process ensures extended shelf life and stability during shipping and storage.

For reconstitution, specific protocols vary by manufacturer and product formulation:

  1. For carrier-containing products: Reconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin .

  2. For carrier-free products: Reconstitute at 100 μg/mL in sterile PBS without additional proteins .

Proper reconstitution is critical for maintaining protein activity and preventing aggregation or denaturation.

Shipping Conditions

These products are typically shipped at ambient temperature as lyophilized powders, often with ice packs to minimize temperature fluctuations . Upon receipt, immediate transfer to appropriate storage conditions is recommended to ensure maximum retention of biological activity.

Key Research Applications

Recombinant Mouse Fas serves as a valuable tool in numerous research areas, including:

  1. Apoptosis research: Studying the mechanisms and regulation of programmed cell death

  2. Immunology: Investigating T-cell homeostasis and peripheral tolerance

  3. Cancer research: Examining tumor cell resistance to apoptosis

  4. Drug development: Screening potential therapeutic modulators of the Fas/FasL pathway

  5. Autoimmune disease studies: Understanding dysregulation of immune cell elimination

The consistent quality and defined properties of recombinant preparations make them particularly suitable for quantitative assays and reproducible experiments across laboratories.

Experimental Design Considerations

When designing experiments with recombinant Mouse Fas, several factors should be considered:

  1. Tag selection: The choice between His-tagged and Fc-tagged versions may impact experimental outcomes, particularly in binding assays or functional studies.

  2. Carrier presence: BSA-containing formulations may be preferable for cell culture but could interfere with certain analytical techniques.

  3. Cross-linking requirements: Some experimental systems may require additional cross-linking antibodies to enhance Fas signaling.

  4. Cell type specificity: The response to Fas stimulation varies significantly across cell types, necessitating validation in each experimental system.

  5. Concentration optimization: Effective concentrations should be empirically determined for each application and cell type.

Quality Control Parameters

Commercial preparations of recombinant Mouse Fas undergo rigorous quality control testing to ensure consistency and reliability. Standard quality control parameters include:

  1. Purity assessment by reducing SDS-PAGE (typically >95%)

  2. Endotoxin testing using the LAL method (typically <1.0 EU per μg)

  3. Protein concentration verification

  4. Identity confirmation via mass spectrometry

  5. Functional activity testing in applicable bioassays

These quality control measures ensure that researchers receive products with consistent performance characteristics across different lots and preparations.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you need dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fas; Apt1; Tnfrsf6; Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-327
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Fas
Target Protein Sequence
QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE
Uniprot No.

Target Background

Function
Fas is a receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) activates caspase-8 proteolytically, initiating a cascade of caspases (aspartate-specific cysteine proteases) that mediates apoptosis. Fas-mediated apoptosis plays a role in inducing peripheral tolerance and in antigen-stimulated suicide of mature T-cells.
Gene References Into Functions
  1. Our computational and experimental approach identified Fas as a regulator of the Th17-to-Th1 cell balance by controlling the availability of opposing STAT1 and STAT3, directly impacting autoimmunity. PMID: 29562202
  2. FGF21 alleviated atherosclerosis by ameliorating Fas-mediated apoptosis in apoE-/- mice. PMID: 30157856
  3. TPD7 altered the extrinsic apoptosis pathway by upregulating Fas expression. PMID: 29901176
  4. In conclusion, these data demonstrate that murine herpesvirus 68-immortalized SL-1 cells can be recognized and controlled by specific cytotoxic T cells through CD95/CD95L-mediated apoptosis. PMID: 28516317
  5. Findings indicate that induction of apoptosis through Fas is dependent on receptor palmitoylation in primary immune cells, and Fas may prevent autoimmunity by mechanisms other than inducing apoptosis. PMID: 28008916
  6. Both Sharpin/Fas and Sharpin/Fasl compound mutant mice developed an auto-inflammatory phenotype similar to that seen in Sharpin null mice, indicating that initiation of apoptosis by FAS signaling is likely not involved in the pathogenesis of this disease. PMID: 28094869
  7. Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. PMID: 29083508
  8. Leucine deprivation induces the expression of miR-212-5p in a GCN2/ATF4-dependent manner. miR-212-5p suppresses lipid accumulation in the liver by targeting FAS and SCD1 under both normal diet and high-fat diet conditions. PMID: 28667176
  9. Our data show that loss of Fas activity strongly affects the early development of atopic dermatitis (AD) by leading to Th2-dominant inflammation characterized by dermal infiltration of CD4+ T cells, neutrophils, and increased skin expression of Th2 cytokines. However, the Fas/FasL-apoptotic pathway is also involved in restricting tissue remodeling and dermal fibrosis during AD. PMID: 28434120
  10. Hrd1-null B cells exhibited high Fas expression during activation and rapidly underwent Fas-mediated apoptosis, which could be largely inhibited by FasL neutralization. Fas mutation in Hrd1 KO mice abrogated the increase in B-cell AICD. We identified Hrd1 as the first E3 ubiquitin ligase of the death receptor Fas and Hrd1-mediated Fas destruction as a molecular mechanism in regulating B-cell immunity. PMID: 27573825
  11. FAS contributes to mitochondrial dysfunction, steatosis development, and insulin resistance under a high-fat diet. PMID: 28883393
  12. These findings reveal a role for MOAP-1 in Fas signaling in the liver by promoting MTCH2-mediated tBid recruitment to mitochondria. PMID: 27320914
  13. The in vivo delivery of CRISPR/Cas9 could maintain liver homeostasis and protect hepatocytes from Fas-mediated cell apoptosis in the fulminant hepatic failure model. PMID: 27585307
  14. This study demonstrated that Ischemic neurons release sFasL, which contributes to M1-microglial polarization. PMID: 27283206
  15. Results indicate that IL-1beta, produced by the inflammasome and Fas-dependent mechanisms, contributes cooperatively to the Th17/Th1 induction during bacterial infection. This study provides a deeper understanding of the molecular mechanisms underlying Th17/Th1 induction during pathogenic microbial infections in vivo. PMID: 28674179
  16. This study shows that CD95-mediated calcium signaling promotes Th17 cell trafficking to inflamed organs in lupus-prone mice PMID: 27438772
  17. Accelerating effects of Tlr9 deficiency PMID: 28278279
  18. K8/K18-dependent PKCdelta- and ASMase-mediated modulation of lipid raft size can explain the more prominent FasR-mediated signaling resulting from K8/K18 loss. PMID: 27422101
  19. Data show that TCF1 protein deficiency relieved most manifestations of autoimmune lymphoproliferative syndrome (ALPS)-like phenotype, which were caused by Fas protein mutation in TCF1(-/-) lpr/lpr mice. PMID: 28349581
  20. Results indicate that the close interaction between Thy-1 and Fas in lipid rafts regulates fibroblast apoptosis, and decreased fibroblast apoptosis associated with myofibroblast accumulation in mice lacking Thy-1. PMID: 28165468
  21. Fas/FasL Complex Promotes Proliferation and Migration of Brain Endothelial Cells Via FADD-FLIP-TRAF-NF-kappaB Pathway PMID: 25427888
  22. Cardiac Fas-dependent and mitochondria-dependent apoptotic pathways were activated in transgenic mice with Huntington's disease. PMID: 25800750
  23. The MWM showed that compared with FAS- and FASL-knockout mice treated with sevoflurane, sevoflurane treatment of wild-type mice significantly prolonged the escape latency and reduced platform crossing times. PMID: 26782453
  24. The individual functions of the NF-kappaB family members NF-kappaB1, NF-kappaB2, and c-REL in the various autoimmune pathologies of Fas(lpr/lpr) mutant mice were investigated. PMID: 26084385
  25. When Bax(-/-)Bak(-/-) murine embryonic stem cells (ESCs) are stimulated to differentiate, a subpopulation fails to do so and instead upregulates FAS in a p53-dependent manner to trigger Bax/Bak-dependent apoptosis. PMID: 26585277
  26. These results demonstrate that during ectromelia virus infection, Fas/FasL can regulate the development of tolerogenic DCs and Tregs, leading to an ineffective immune response. PMID: 26780774
  27. Data determined the transmembrane domain structure of Fas and showed that the trimer assembly, which is mediated by a proline-containing motif, is essential for Fas signaling, providing a structural explanation for many known cancer mutations in this domain. PMID: 26853147
  28. Impaired Fas-Fas Ligand Interactions Result in Greater Recurrent Herpetic Stromal Keratitis in Mice PMID: 26504854
  29. miR-150 deficiency prevents Fas-induced hepatocyte apoptosis and liver injury through regulation of the Akt pathway PMID: 26196694
  30. CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production. PMID: 26095930
  31. The upregulation of p-FADD/FADD ratio and NF-kappaB in mouse hippocampus after Kainic acid treatment PMID: 26044520
  32. Demonstrates that the Fas/FasL pathway during ectromelia virus infection of the lungs plays an important role in controlling the local inflammatory response and mounting of the antiviral response PMID: 25873756
  33. Mice with the Fas(lpr) gene developed severe systemic lupus erythematosus with renal dysfunction and inflammatory responses in the lung and kidney. By contrast, mice with the Fas(+) gene showed disease-related abnormalities in the liver and joints. PMID: 25941813
  34. Occlusive lung arterial lesions triggering pulmonary arterial hypertension developed in a new model of endothelial-targeted, Fas-induced apoptosis transgenic mice. PMID: 25879383
  35. Gene silencing of liver Fas expression completely attenuated apoptotic and necrotic cell death. PMID: 25601293
  36. Our results demonstrate that Fas/FasL can regulate the development of tolerogenic dendritic cells and expansion of Tregs early during HSV-2 infection, which further influences the effective antiviral response. PMID: 25129477
  37. Our data support a model in which IFNgamma- and Fas/FasL-dependent activation of intratumoral Mvarphis by CD8(+) T cells promotes severe intraocular inflammation that indirectly eliminates intraocular tumors by inducing phthisis. PMID: 25248763
  38. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce the expression of CD95. PMID: 24981893
  39. These data provide the first in vivo genetic evidence that neutrophil lifespan is controlled by death receptor signaling and provide a mechanism to account for neutrophil resistance to Fas stimulation during infection. PMID: 25473101
  40. Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation. PMID: 25378591
  41. Overexpression of Fas/FasL is associated with infectious complications and severity of experimental severe acute pancreatitis by promoting apoptosis of lymphocytes PMID: 24566874
  42. No significant association between FAS-670G/A polymorphism and susceptibility to autoimmune hepatitis was found. PMID: 24629822
  43. A key role of MK2 and FasR in the regulation and limitation of the immune response in the CNS PMID: 24964076
  44. These data show that loss of Fas activity specifically in chondrocytes prolonged the life span of chondrocytes and that Fas synergized with TNFalpha signaling to mediate chondrocyte apoptosis. PMID: 24677136
  45. Although expression of Fas and TNF-R1 was proportionate to fractional apoptosis, cell death was dominated by spontaneous apoptosis in stem cell mobilization. PMID: 24566711
  46. Data suggest that toll-like receptor 3 (TLR3), phosphatidylinositol 3-kinase (PI3K), survivin, Fas ligand (FasL), and CD95 (Fas) genes are involved in the development of cervical cancer. PMID: 25106857
  47. The Fas KO mice spontaneously develop blepharitis with not only autoimmune inflammation with deposition of auto-antibody but also allergic inflammation with infiltration by eosinophils and show to increase serum level of IgE and IgG1. PMID: 23220580
  48. D-cyclins repress the expression of the death receptor Fas and its ligand, FasL PMID: 25087893
  49. Data indicate that dendritic cells (DCs)-specific CD95 (Fas) expression plays a role in the regulation of antiviral responses and suggests a strategy for stimulation of T cells for virus clearance in chronically infected animals and humans. PMID: 24912151
  50. Combined adenovirus-mediated artificial microRNAs targeting mfgl2, mFas, and mTNFR1 protect against fulminant hepatic failure in mice. PMID: 24303082

Show More

Hide All

Database Links

KEGG: mmu:14102

STRING: 10090.ENSMUSP00000025691

UniGene: Mm.1626

Involvement In Disease
Defects in Fas are the cause of the lymphoproliferation phenotype (lpr). Lpr mice show lymphadenopathy and autoantibody production.
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Tissue Specificity
Detected in various tissues including thymus, liver, lung, heart, and adult ovary.

Q&A

What is Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (Fas) and what is its role in normal physiology?

Recombinant Mouse Fas (also known as CD95, Apo1, or TNFRSF6) is a laboratory-synthesized version of the naturally occurring Fas protein. It is a type I transmembrane protein belonging to the tumor necrosis factor receptor superfamily (TNFRSF). While primarily recognized as a death receptor that mediates apoptosis when engaged by its ligand (FasL), research has demonstrated that Fas can also convey survival and proliferation signals under specific cellular conditions .

In normal physiology, Fas plays a crucial role in regulating programmed cell death, particularly in the immune system where it helps maintain homeostasis by eliminating activated lymphocytes after an immune response. The liver has been shown to be especially susceptible to Fas-mediated cytotoxicity in mouse models .

How does the structure of Mouse Fas compare to other TNF receptor superfamily members?

Fas shares structural similarities with other TNF receptor superfamily members, particularly in its characteristic extracellular domain with cysteine-rich motifs and an intracellular death domain. While the search results don't provide specific structural details about Fas itself, comparison with Death Receptor 6 (DR6/TNFRSF21) indicates that these receptors typically contain multiple cysteine-rich motifs in their extracellular domains followed by a transmembrane segment and a cytoplasmic region containing a death domain .

The recombinant form is designed to maintain these structural features while potentially incorporating modifications that facilitate experimental use, such as tags for purification or detection.

What experimental models are best suited for studying Fas-mediated mechanisms?

Liver models are particularly well-established for studying Fas-mediated effects, as research has shown that administration of agonistic anti-Fas antibody leads to rapid and severe liver injury in wild-type mice . This makes hepatocyte cultures and mouse liver injury models excellent systems for investigating Fas-mediated apoptosis.

When selecting experimental models, researchers should consider:

  • Cell-based systems: Hepatocytes, activated T cells, and certain cancer cell lines show high sensitivity to Fas-mediated apoptosis

  • Genetic models: Mice with various genetic backgrounds, including TNFR1/TNFR2 knockout mice, which show resistance to Fas-mediated liver injury

  • Ex vivo systems: Precision-cut liver slices or isolated primary cells that maintain tissue architecture while allowing experimental manipulation

For methodologically sound experiments, each model system should include appropriate controls as detailed in later sections of this FAQ.

How should experimental designs account for potential contradictions in Fas-mediated signaling?

Fas signaling can lead to seemingly contradictory outcomes (apoptosis versus survival/proliferation) depending on the cellular context. To account for these contradictions:

  • Use multiple readouts to measure both apoptotic and non-apoptotic outcomes

  • Investigate dose-dependency, as different concentrations may trigger different signaling pathways

  • Consider cell type specificity by including diverse cell types

  • Assess the cytokine microenvironment, as this may influence Fas signaling outcomes

  • Examine temporal dynamics of signaling events

  • Account for genetic background effects, as demonstrated by the dramatic differences between wild-type and TNFR knockout mice in response to Fas activation

When analyzing contradictory results, consider employing multivariate analysis methods similar to the partial least squares (PLS) analyses used in personality trait research , which can help identify complex relationships between multiple variables in your experimental data.

What are the appropriate controls for experiments using Recombinant Mouse Fas?

Robust experimental design with appropriate controls is essential:

Negative controls:

  • Untreated cells or tissues

  • Treatment with denatured or functionally inactive recombinant protein

  • Isotype control antibodies (when using anti-Fas antibodies)

Positive controls:

  • Known inducers of apoptosis

  • Validated Fas-activating antibodies or recombinant FasL

Specificity controls:

  • Pre-blocking with anti-Fas antibodies

  • Use of Fas-deficient cells or tissues (knockout models)

  • Treatment with caspase inhibitors to confirm involvement of apoptotic pathways

Genetic controls:

  • Wild-type versus knockout comparisons (e.g., TNFR1/2 knockout mice show resistance to Fas-mediated effects)

  • Examination of different genetic backgrounds or strains

  • Analysis of specific genetic polymorphisms that may affect Fas signaling

For in vivo experiments, particularly those involving liver injury, monitoring liver enzyme levels (ALT, AST) in the serum provides quantitative measures of injury severity.

What are the best methods for detecting Fas expression and activation in mouse tissues?

Multiple complementary techniques should be employed:

For detecting Fas expression:

  • Immunohistochemistry: Visualizes Fas protein in tissue sections with preserved histological context

  • Flow cytometry: Enables quantitative analysis of Fas expression on individual cells

  • Western blotting: Provides information about total Fas protein levels

  • RT-PCR or qPCR: Measures Fas mRNA expression levels

For detecting Fas activation:

  • TUNEL assay: Detects DNA fragmentation, a hallmark of apoptosis

  • Caspase activity assays: Measures activation of caspases downstream of Fas signaling

  • Annexin V staining: Detects phosphatidylserine externalization, an early marker of apoptosis

  • Protease activation assays: Research shows that various proteases are activated following anti-Fas antibody treatment, including caspase-3, -8, and -9-like proteases, calpains, and cathepsin B

How do genetic variations in Fas affect its function and signaling capacity?

Genetic variations can significantly impact Fas function and signaling. Research on FAS polymorphisms has revealed:

  • The FAS-670 GG genotype polymorphism is associated with lower FAS mRNA expression levels (P(H1) = 0.027) , suggesting that variations in regulatory regions can affect transcription and protein availability.

  • Other potential effects of genetic variations include:

    • Modified protein structure affecting ligand binding

    • Altered post-translational modifications

    • Changes in subcellular localization

    • Differential interaction with adapter proteins

The following data demonstrates how genetic polymorphisms can be linked to expression levels:

GeneExpressionCI (95%)P(H1)Result
FAS-670, GG × GA + AA0.6010.124-2.1570.027DOWN
FAS-L-844 CC × CT + TT0.9140.500-1.6930.764ND

Abbreviations: CI, confidence interval; P(H1), probability of the alternate hypothesis that the difference between the sample and control groups is due only to chance; ND, sample group is not different than the control group; DOWN, downregulated.

These findings highlight the importance of considering genetic background when studying Fas-mediated effects.

What is the relationship between Fas and TNF receptor signaling pathways in experimental models?

Research has revealed a critical interplay between Fas and TNF receptor signaling pathways:

  • Mice lacking TNFR1 and TNFR2 (R-) survive a single dose of agonistic anti-Fas antibody that is rapidly lethal to wild-type mice (R+) .

  • TNFR-deficient mice develop only mild hepatic damage compared to the severe liver injury observed in wild-type mice , suggesting that TNF receptor signaling is required for full deployment of Fas toxicity.

  • The molecular mechanisms underlying this interaction involve:

    • DNA-binding activity of NF-κB is enhanced after anti-Fas antibody treatment, but much more markedly in TNFR-deficient mice than in wild-type mice

    • Bcl2 is markedly upregulated in TNFR-deficient but not in wild-type mice challenged with anti-Fas antibody

    • Differential activation of proteases of different families (caspase-3-, -8-, and -9-like, calpains, cathepsin B)

These findings indicate that treatment with anti-Fas antibody somehow activates the TNFα-TNFRs system, and this activation synergizes with Fas-mediated signals to cause fulminant liver injury . This interaction must be considered when designing and interpreting Fas-related experiments.

How can quasi-experimental designs enhance Fas research when randomized controlled trials are not feasible?

When randomization is not possible, several quasi-experimental designs can still provide valuable insights:

  • Pre-post designs with non-equivalent control groups: Compare changes before and after Fas intervention between non-randomly assigned groups. This approach is particularly useful when studying naturally occurring genetic variations in Fas or its signaling partners .

  • Interrupted time series (ITS): Collect multiple measurements before and after introducing Fas or its agonists to detect changes in trends and distinguish intervention effects from background fluctuations .

  • Stepped wedge designs: Introduce the Fas intervention to different groups in a staggered fashion, allowing each group to serve as its own control .

To enhance validity in these designs:

  • Use multiple methods to study the same phenomenon

  • Verify findings across different laboratories and experimental systems

  • Test findings in diverse models to ensure generalizability

  • Confirm proposed mechanisms through targeted interventions

These approaches are particularly valuable when studying complex phenomena such as the interplay between Fas and TNF receptor signaling or the effects of genetic polymorphisms on Fas function .

How should dose-response relationships for Fas-mediated effects be analyzed?

Analyzing dose-response relationships for Fas-mediated effects requires:

  • Non-linear modeling: Fas-mediated effects often show sigmoidal dose-response curves. Use appropriate mathematical models (e.g., four-parameter logistic models) for curve fitting.

  • EC50/IC50 determination: Calculate the effective or inhibitory concentration that produces 50% of the maximal response. For related recombinant proteins, concentrations producing 50% of optimal binding response have been reported in the range of 80-400 ng/mL .

  • Statistical analysis:

    • Two-way ANOVA with dose and experimental condition as factors

    • Extra sum-of-squares F test for comparing EC50 values

    • Bootstrap resampling for confidence intervals

  • Multiple endpoints analysis: Measure and analyze various outcomes (e.g., caspase activation, phosphatidylserine externalization, DNA fragmentation) separately, as they may show different dose dependencies.

  • Time-dependency consideration: Include time as a variable, particularly for in vivo studies where effects can develop rapidly (within hours) following antibody administration .

What statistical methods are appropriate for analyzing contradictory results in Fas-related experiments?

When faced with contradictory results:

  • Multivariate analyses: Partial least squares (PLS) analysis can identify relationships between multiple variables that may explain contradictions, similar to approaches used in personality trait research .

  • Bayesian methods: These can incorporate prior knowledge and update beliefs based on new evidence, providing a framework for reconciling contradictory findings.

  • Subgroup analyses: Stratifying data based on relevant factors (e.g., genetic background, cell type) may reveal that contradictions are actually consistent within specific contexts.

  • Probabilistic hypothesis testing: Expressing results in terms of the probability of the alternate hypothesis (P(H1)) provides more nuanced interpretation than traditional p-values .

For example, in one study, FAS-L mRNA was upregulated in patients compared to controls (P(H1) = 0.000), while there was a significant association between FAS-670 GG genotype polymorphism and lower FAS mRNA levels (P(H1) = 0.027) . These findings can be integrated using the statistical approaches mentioned above to develop a comprehensive understanding of seemingly contradictory results.

How might advanced experimental designs help resolve current contradictions in Fas research?

Advanced experimental designs offer several advantages for resolving contradictions:

  • Factorial designs: These systematically test multiple factors simultaneously and identify interactions. For example, a factorial design could examine how cell type, cytokine environment, and genetic background interact to determine Fas-mediated outcomes.

  • Systems biology approaches: Computational models integrating multiple datasets can identify patterns explaining seemingly contradictory results.

  • Single-cell analyses: Technologies such as single-cell RNA-seq can reveal heterogeneity within cell populations that might explain contradictions observed at the population level.

  • In vivo imaging: Real-time imaging of Fas-mediated processes can provide temporal and spatial information that helps resolve contradictions based on endpoint analyses.

  • Interrupted time series designs: These can help distinguish the effects of Fas activation from background trends and fluctuations .

Each of these approaches provides unique insights and, when combined, can create a more complete understanding of complex Fas-mediated mechanisms.

What are the implications of TNF receptor-Fas interactions for therapeutic targeting of death receptor pathways?

The discovery that mice lacking TNFR1 and TNFR2 are resistant to Fas-mediated liver injury has significant therapeutic implications:

  • Combination approaches: Targeting both Fas and TNF receptor pathways simultaneously may be more effective than targeting either pathway alone.

  • Context-dependent interventions: The therapeutic strategy should consider tissue-specific interactions between these pathways.

  • Biomarker development: The expression levels and activation states of both receptor systems could serve as biomarkers for predicting response to death receptor-targeted therapies.

  • Safety considerations: The severe liver injury resulting from Fas activation in the presence of functional TNF receptors suggests that therapeutic agents targeting Fas must be carefully evaluated for hepatotoxicity.

  • Protective strategies: Understanding how TNFR-deficient mice upregulate Bcl2 in response to Fas activation could lead to protective strategies against Fas-mediated tissue damage.

These insights highlight the need for a systems-level understanding of death receptor interactions when developing targeted therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.