Recombinant Mouse Tumor protein p53-inducible protein 11 (Trp53i11)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Trp53i11 is typically produced in E. coli expression systems with an N-terminal His-tag for affinity chromatography .

Functional Role in p53 Signaling

Trp53i11 is transcriptionally activated by p53 under cellular stress. Its roles include:

  • Apoptosis Induction: Enhances arsenic trioxide (As₂O₃)-mediated apoptosis in cancer cells by modulating redox pathways .

  • Tumor Suppression: Acts as a pro-apoptotic factor in gastric and other cancers .

  • Chemical Response: Expression is modulated by environmental toxins (e.g., TCDD, bisphenol A) and chemotherapeutic agents .

A. In Vitro Assays

  • Apoptosis Studies: Used to quantify Trp53i11's role in arsenic trioxide-treated cell lines (e.g., human gastric cancer MGC-803 cells) .

  • Protein Interaction Mapping: Facilitates binding assays with p53 and other apoptosis regulators .

B. Detection Tools

Kit ParameterDetails
ELISA KitMouse Trp53i11 ELISA (Abbexa, Cat# abx151597)
Detection Range0.156–10 ng/mL
Sample CompatibilityTissue homogenates, cell lysates

A. Mechanistic Insights

  • Overexpression of Trp53i11 sensitizes cells to arsenic trioxide, amplifying apoptotic effects .

  • Trp53i11 expression is upregulated by DNA-damaging agents (e.g., camptothecin) and downregulated by endocrine disruptors (e.g., bisphenol A) .

B. Pathway Interactions

StimulusEffect on Trp53i11 ExpressionCitation
Arsenic trioxide↑ Apoptosis in gastric cancer
2,3,7,8-TCDD (dioxin)↓ mRNA levels in rat models
Camptothecin↑ mRNA in human cells

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
Trp53i11; Pig11; Tp53i11; Tumor protein p53-inducible protein 11; Transformation related protein 53 inducible protein 11; p53-induced gene 11 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Trp53i11
Target Protein Sequence
MAGKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFLSAMLFSSVAIMALALPDQLYDAVFDGAEVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFGVQSLVVTATLAETGLMSLGTVLLLASRLLFVIVSIYYYY QVGRKPKKV
Uniprot No.

Target Background

Database Links

KEGG: mmu:277414

UniGene: Mm.41033

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Trp53i11 and how does it relate to human TP53I11?

Trp53i11 is the mouse homolog of human TP53I11 (also known as PIG11), which was first identified as a p53-inducible gene in human colon cancer cells using Serial Analysis of Gene Expression (SAGE) technology. The human variant is located on chromosome 11p11.2, and the mouse variant shares significant sequence homology and functional similarity . Both were initially characterized as p53 transcriptional targets, though subsequent research has revealed that many of their functions operate through p53-independent mechanisms as well . The protein is primarily expressed in mammary gland, liver, and gastrointestinal tissues, with altered expression observed in various cancer types .

What molecular mechanisms does Trp53i11 participate in?

Trp53i11 functions as a mediator that balances activation of AKT and AMPK to adapt cells to different cellular contexts. Research demonstrates that it regulates:

  • Extracellular matrix (ECM)-independent survival mechanisms

  • Epithelial-mesenchymal transition (EMT) processes

  • Cell migration and metastatic potential

  • Metabolic pathways including oxidative phosphorylation (OXPHOS)

  • Angiogenesis in endothelial cells

What are the optimal methods for producing recombinant mouse Trp53i11?

Producing high-quality recombinant mouse Trp53i11 requires careful consideration of expression systems and purification protocols:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, cost-effectivePotential improper folding, lack of post-translational modificationsStructural studies, antibody production
Mammalian cell linesProper folding, post-translational modificationsLower yield, higher costFunctional assays, protein-protein interaction studies
Baculovirus/insect cellsIntermediate yield, eukaryotic processingModerate cost, technical complexityBalance between yield and proper processing

For optimal purification, a two-step approach is recommended:

  • Initial capture using affinity chromatography (His-tag or GST-tag)

  • Secondary purification via size-exclusion chromatography to achieve >95% purity

The recombinant protein should be validated through Western blotting and mass spectrometry to ensure proper expression and modification status before experimental use .

How can Trp53i11 expression be efficiently manipulated in mouse models?

Several approaches have been developed to manipulate Trp53i11 expression in mouse models:

For overexpression studies:

  • Plasmid-based transient transfection shows approximately 75% transfection efficiency when monitored using eGFP reporters

  • Lentiviral vectors provide stable expression and can be targeted to specific tissues using tissue-specific promoters

  • Conditional expression systems (Tet-On/Tet-Off) allow temporal control of expression

For knockdown/knockout studies:

  • CRISPR/Cas9 lentiviral systems have demonstrated effective knockout, with validation through Western blot analysis

  • shRNA approaches targeting specific regions of Trp53i11 mRNA (TP53I11-shRNA) provide an alternative for partial knockdown

  • Conditional knockout mouse models allow tissue-specific and temporal deletion of Trp53i11

When designing these experiments, researchers should consider the baseline expression levels of Trp53i11 in the target tissue, as this varies significantly across different cell types and may affect the efficiency of manipulation strategies .

How does Trp53i11 influence EMT and metastasis in cancer models?

Trp53i11 plays a complex role in regulating EMT and metastasis:

Studies using MDA-MB-231 cells demonstrated that TP53I11 suppresses EMT and cell migration in vitro and inhibits metastasis to mice lungs in vivo . Loss of TP53I11 enhances EMT and migration in MCF10A cells, while overexpression suppresses these processes . These findings suggest Trp53i11 functions as a metastasis suppressor in breast cancer models.

The mechanism appears to involve:

  • Regulation of ECM-independent survival, which is an essential prerequisite for tumor metastasis

  • Modulation of anoikis resistance pathways through AMPK/AKT signaling

  • Direct or indirect effects on epithelial and mesenchymal markers

When designing metastasis studies with Trp53i11, researchers should implement:

  • Multi-timepoint sampling to capture the dynamic nature of metastatic progression

  • Parallel analysis of circulating tumor cells and distant organ colonization

  • Comprehensive profiling of EMT markers to establish mechanistic connections

  • Comparison across multiple cell lines to account for genetic background variations

What role does Trp53i11 play in angiogenesis and how can this be studied?

Recent evidence indicates that TP53I11 significantly affects endothelial cell function and angiogenesis:

In vitro findings:

  • Overexpression of TP53I11 significantly increases microvessel sprouting, tube formation, proliferation, and migration in HUVECs under both normoxic and hypoxic conditions

  • Knockout of TP53I11 attenuates these angiogenic processes in endothelial cells

  • Hypoxia enhances the angiogenic capacity of endothelial cells, with TP53I11 potentially serving as a mediator of this response

Methodological approaches for studying Trp53i11 in angiogenesis:

  • Aortic ring assays to measure microvessel sprouting (quantified by counting branch points)

  • Matrigel tube formation assays (assessed by total tube length and number of branch points)

  • Endothelial cell proliferation using EdU incorporation assays

  • Wound healing and transwell migration assays to assess endothelial mobility

  • Co-culture systems with tumor cells to examine paracrine effects

These findings highlight the potential importance of Trp53i11 in tumor angiogenesis and suggest it may represent a novel target for anti-angiogenic therapies in cancer .

How does Trp53i11 interact with the AMPK/AKT signaling balance?

Trp53i11 serves as a critical mediator balancing AKT and AMPK activation in response to cellular attachment status:

Cellular ContextEffect of Trp53i11 LossSignaling Pathway AlterationMetabolic Outcome
ECM-attached cellsEnhanced proliferation↑ AKT/mTOR activation, ↑ PGC-1α expression↑ OXPHOS
ECM-detached cellsAnoikis resistance↑ AMPK activation, ↓ AKT/mTOR/p70S6K signalingMetabolic adaptation

This context-dependent signaling switch suggests Trp53i11 functions as a metabolic sensor that helps cells adapt to different microenvironmental conditions. The reciprocal inhibitory relationship between AKT and AMPK appears to be modulated by Trp53i11, particularly during ECM detachment - a critical step in metastasis .

To study this mechanism:

  • Use compound C (AMPK inhibitor) and rapamycin (mTOR inhibitor) to probe pathway dependencies

  • Monitor phosphorylation status of key signaling nodes (pAMPK, pAKT, p-p70S6K) under different attachment conditions

  • Employ metabolic profiling (Seahorse XF Analyzer) to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

  • Compare wild-type, knockout, and rescue models to establish causality in signaling alterations

How can contradictory findings about Trp53i11 function be reconciled?

The scientific literature reveals apparent contradictions regarding Trp53i11/TP53I11 function, with evidence supporting both tumor-suppressive and tumor-promoting roles:

Evidence for tumor suppression:

  • Suppresses EMT and metastasis in breast cancer cells

  • Inhibits migration in certain cellular contexts

  • Associated with enhanced apoptosis in liver cancer cells

Evidence for tumor promotion:

  • Elevated expression in gastric cancer correlates with invasive depth, lymph node metastasis, and poor survival

  • High levels associated with elevated carcinoembryonic antigen levels

  • Promotes angiogenesis in endothelial cells

These contradictions can be reconciled through several considerations:

Researchers should design experiments that systematically address these variables to clarify the context-dependent functions of Trp53i11 .

What considerations are important when interpreting Trp53i11 data across different mouse models?

When comparing Trp53i11 data across different mouse models, researchers should consider:

  • Mouse strain background: Different strains may have different baseline metabolic profiles and cancer susceptibilities that influence Trp53i11 function

  • p53 mutational status: The presence of different p53 mutations can dramatically alter Trp53i11 function as seen in the conditional mutant Trp53 allele models where p53R245W tumors are more aggressive than p53R172H tumors

  • Spatial expression pattern: Consider whether Trp53i11 manipulation occurs in single cells surrounded by normal stroma vs. whole-tissue manipulation

  • Temporal induction: The timing of Trp53i11 manipulation relative to tumor initiation may yield different phenotypes

  • Metastatic potential: Different models show varying metastatic capabilities, with some requiring additional mutations beyond Trp53i11 alterations

To address these variables, comprehensive experimental designs should include:

  • Multiple mouse strains when possible

  • Both germline and conditional models

  • Parallel in vitro validation in cell lines derived from the same genetic background

  • Detailed characterization of p53 pathway status in experimental models

What are the most promising areas for future Trp53i11 research?

Based on current findings, several high-priority research areas emerge:

  • Trp53i11 in tumor microenvironment interactions: Investigating how Trp53i11 in cancer cells affects surrounding stroma, immune cells, and angiogenesis

  • Metabolic reprogramming: Further characterizing the role of Trp53i11 in metabolic adaptation during cancer progression, particularly in nutrient-limited conditions

  • Biomarker potential: Evaluating whether Trp53i11 expression patterns can serve as prognostic or predictive biomarkers in different cancer types

  • Therapeutic targeting: Developing approaches to modulate Trp53i11 function, particularly in contexts where it promotes cancer progression

  • Synthetic lethality: Identifying genetic or pharmacological interventions that create synthetic lethality with Trp53i11 alterations

Methodological advances needed include:

  • Single-cell analysis of Trp53i11 function in heterogeneous tumors

  • Spatial transcriptomics to map Trp53i11 expression in complex tissues

  • Advanced mouse models that better recapitulate human cancer progression

  • Proteomic identification of Trp53i11 interaction partners in different cellular contexts

How might targeting Trp53i11 translate to therapeutic applications?

The potential for Trp53i11-based therapeutic strategies depends on its context-dependent functions:

In contexts where Trp53i11 acts as a tumor suppressor:

  • Gene therapy approaches to restore Trp53i11 expression

  • Small molecules that mimic or enhance Trp53i11 function

  • Targeting downstream pathways activated by Trp53i11 loss

In contexts where Trp53i11 promotes cancer progression:

  • RNA interference or antisense oligonucleotides to reduce Trp53i11

  • Small molecule inhibitors of Trp53i11 protein-protein interactions

  • Anti-angiogenic approaches targeting Trp53i11-dependent endothelial functions

The most promising initial applications may be in those cancers where Trp53i11 shows a clear role in promoting progression, such as certain gastric cancers with elevated Trp53i11 expression. Combination approaches targeting both Trp53i11 and related pathways (AMPK/AKT) may be particularly effective in overcoming resistance mechanisms .

Given the context-dependent function of Trp53i11, companion diagnostics to identify patients likely to benefit from Trp53i11-targeted therapies will be essential for successful clinical translation of these research findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.