Recombinant Mouse Type I iodothyronine deiodinase (Dio1)

Shipped with Ice Packs
In Stock

Description

Introduction

Iodothyronine deiodinases are essential mediators of thyroid hormone (TH) action, found throughout the body's tissues . They catalyze 3,5 deiodination, which is vital for thyroid hormone metabolism . Among these, Type I iodothyronine deiodinase (Dio1) is a non-selective enzyme that catalyzes both outer ring deiodination (ORD) and inner ring deiodination (IRD) .

Structure and Function of Dio1

The biochemical characteristics of the D1 enzyme were originally determined using rat liver homogenates and microsomes . D1 is characterized by high $$K_m$$ and its ability to catalyze both ORD and IRD reactions . The enzyme's efficiency for ORD of rT3 is over 100-fold higher than for ORD of T4, while the sulphation of T4 and T3 significantly increases IRD efficiency . In vitro deiodination requires a reducing cofactor, such as dithiothreitol (DTT) . Dio1 exhibits ping-pong kinetics and is strongly inhibited by 6-n-propyl-2-thiouracil (PTU) . Enzyme activity is also inhibited by iodoacetate (IAc) and iopanoic acid (IOP) .

Genetic Basis and Expression

The type 1 deiodinase (D1) provides a major portion of the circulating T3 in vertebrates . Research has shown that inbred C3H mice exhibit 5- to 10-fold lower liver and kidney D1 activity compared to C57 mice . This difference is associated with decreased normal-sized dio1 mRNA and hyperthyroxinemia . This diminished activity is linked to a restriction fragment length variant (RFLV) within the dio1 gene .

The exonic structure and deduced amino acid sequences are highly homologous to that of the rat . The RFLV is caused by an approximately 150-base pair expansion of repetitive sequences in the second intron of the C3H gene, but this segment does not differentially affect the transient expression of a human GH gene . Functional assays of 1.5-kilobase 5'-flanking dio1-CAT constructs showed 2- to 3-fold higher activity of the C57-CAT constructs . A 21-base pair insert containing five CTG repeats in the C3H promoter correlates with low D1 activity and the intron RFLV in other mouse strains .

Role in Thyroid Hormone Economy

Studies involving D1-deficient mice (D1KO), created through targeted disruption of the Dio1 gene, have provided insights into the enzyme's role in thyroid hormone economy . D1 deficiency results in marked changes in the metabolism and excretion of iodothyronines . Fecal excretion of endogenous iodothyronines is greatly increased in D1KO mice . Additionally, fecal excretion of [125I]iodothyronines is significantly higher in D1KO mice after injection of [125I]T4 or [125I]T3, while urinary excretion of [125I]iodide is markedly diminished . The majority of iodide generated by D1 comes from substrates other than T4 .

Clinical Significance and Implications

Serious illness is associated with a decrease in circulating T3, known as the nonthyroidal illness syndrome . Cytokine-induced decrease in hepatic type 1 iodothyronine deiodinase (D1) contributes to this syndrome . Studies have shown that IL-1 blocks the ability of T3 to induce D1 in rat hepatocyte primary cultures, and forced expression of steroid receptor co-activator 1 (SRC-1) prevents this cytokine effect .

Impact on ApoA-I Expression

Dio1 expression was significantly reduced in acute or chronic liver-specific insulin receptor knockout mice . Overexpression of Dio1 in liver-specific insulin receptor knockout mice restored plasma levels of high-density lipoprotein cholesterol and apoA-I, and apoA-I gene expression . Dio1 regulates apoA-I promoter activity in a region that is not affected by thyroid hormone and has no thyroid response elements .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Dio1; Itdi1; Txdi1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dio1
Target Protein Sequence
MGLPQLWLWLKRLVIFLQVALEVAVGKVLMTLFPGRVKQSILAMGQKTGMARNPRFAPDN WVPTFFSIQYFWFVLKVRWQRLEDRAEFGGLAPNCTVVCLSGQKCNIWDFIQGSRPLVLN FGSCTUPSFLLKFDQFKRLVDDFASTADFLIIYIEEAHATDGWAFKNNVDIRQHRSLQER VRAARLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRICYKGKAGPWNYNPEEV RAVLEKLCTPPRHVPQL
Uniprot No.

Target Background

Function

Recombinant Mouse Type I iodothyronine deiodinase (Dio1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2).

Gene References Into Functions
  1. Reductions in Dio1 expression decrease ApoA-I expression independently of 3,5,3'-triiodothyronine or thyroid hormone response elements. PMID: 27150392
  2. Mice lacking all three deiodinases are viable and breedable under controlled research vivarium conditions. PMID: 24949664
  3. Systemic alterations in thyroid hormone metabolism during acute starvation are not reliant on D1 or D2 but partially involve tissue sequestration of T4 and T3 and enhanced metabolism by D3. PMID: 24635350
  4. D1 activity in white adipose tissue varies with adiposity, and leptin stimulates D1 activity in this tissue. PMID: 19929143
  5. Significant age- and thyroid state-dependent variations in D1, D2, and D3 expression are observed in central and peripheral mouse tissues during the first three weeks of life. PMID: 12586753
  6. Reduced hepatic D1 activity may underlie some abnormal thyroid parameters seen in cystic fibrosis. PMID: 15463895
  7. Type 1 iodothyronine deiodinase (D1) is expressed in the mouse thyroid. PMID: 15591136
  8. D1 is a crucial source of T3 in the euthyroid state. PMID: 16223863
  9. Cytokine-induced reduction in hepatic D1 contributes to nonthyroidal illness syndrome. PMID: 16601141
  10. HNF4α regulates thyroid hormone homeostasis by transcriptionally regulating Dio1 with GATA4 and KLF9. PMID: 18426912
  11. D1 plays a role in iodide conservation by acting as a scavenger enzyme in peripheral tissues and the thyroid. PMID: 19196796
Database Links
Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Type I iodothyronine deiodinase (Dio1) and what is its role in thyroid hormone metabolism?

Type I iodothyronine deiodinase (Dio1) is a selenoenzyme that plays a crucial role in thyroid hormone metabolism. Unlike the other deiodinase enzymes (Dio2 and Dio3), Dio1 is non-selective and catalyzes both outer ring deiodination (ORD) and inner ring deiodination (IRD) of thyroid hormones . This dual functionality allows Dio1 to convert thyroxine (T4) to the more active triiodothyronine (T3) through ORD, while also being capable of converting T3 to inactive forms through IRD. Dio1 is particularly important for maintaining circulating T3 levels and for the clearance of reverse T3 (rT3) . The enzyme exhibits distinctive biochemical properties including sensitivity to inhibition by 6-n-propyl-2-thiouracil (PTU), relatively high Km values for its preferred substrates, and ping-pong reaction kinetics .

How does Dio1 differ structurally and functionally from Dio2 and Dio3?

The three iodothyronine deiodinases (Dio1, Dio2, and Dio3) exhibit important structural and functional differences:

PropertyDio1Dio2Dio3
Catalytic activityBoth ORD and IRDOnly ORDOnly IRD
PTU sensitivityHighLowLow
Substrate preferencerT3 > T4 > T3T4 > rT3T3 > T4
Reaction kineticsPing-pongSequentialSequential
Primary locationLiver, kidney, thyroidBrain, pituitary, brown adipose tissueBrain, placenta, fetal tissues
Half-lifeModerateShortLong

Dio1 is unique in its ability to catalyze both ORD and IRD reactions, whereas Dio2 exclusively performs ORD and Dio3 exclusively performs IRD . Additionally, Dio1 is highly sensitive to inhibition by PTU, which can be used experimentally to distinguish its activity from other deiodinases. These functional differences reflect their distinct physiological roles: Dio1 contributes significantly to circulating T3 levels, Dio2 provides intracellular T3 in specific tissues, and Dio3 primarily inactivates thyroid hormones .

What are the optimal expression systems for producing functional recombinant mouse Dio1?

The production of functional recombinant mouse Dio1 requires careful consideration of expression systems to ensure proper folding, post-translational modifications, and enzymatic activity. Several expression systems have been evaluated for Dio1 production:

Expression SystemAdvantagesLimitationsYieldActivity
E. coliCost-effective, rapid growthLacks selenocysteine insertion machineryLow-moderateLimited
Mammalian cells (HEK293, CHO)Proper folding, selenocysteine incorporationHigher cost, slower productionModerateHigh
Baculovirus-infected insect cellsScalable, post-translational modificationsMedium complexityHighHigh
Yeast (P. pastoris)Scalable, eukaryotic processingMay require codon optimizationModerateModerate

For functional studies requiring fully active enzyme, mammalian expression systems are generally preferred as they contain the necessary machinery for selenocysteine incorporation at the active site (UGA codon) . The pcDNA3.1 vector system with a DYKDDDDK (FLAG) tag has been successfully used for expressing functional Dio1 . When using these systems, co-expression with selenocysteine insertion sequence (SECIS) elements and supplementation with sodium selenite (0.1-0.5 μM) in the culture medium significantly improves functional enzyme yield.

How can researchers accurately measure Dio1 enzymatic activity in experimental settings?

Accurate measurement of Dio1 enzymatic activity is crucial for studying its function and regulation. Multiple methodological approaches exist, each with specific advantages:

  • Sandell-Kolthoff (SK) Reaction-Based Assay: This colorimetric method measures iodide released during deiodination through its catalytic effect on the reduction of cerium ammonium sulfate by arsenious acid. The DIO1-SK assay has been validated by the European Union Reference Laboratory for alternatives to animal testing (EU RL ECVAM) and is useful for high-throughput screening of potential Dio1 inhibitors .

  • Radioactive Substrate Assays: Using 125I-labeled thyroid hormones (T4, T3, or rT3) allows detection of deiodination through measurement of released 125I. This approach offers high sensitivity but requires radioactive material handling facilities.

  • Liquid Chromatography-Mass Spectrometry (LC-MS/MS): This non-radioactive method provides precise quantification of substrate and product thyroid hormones with high specificity.

For optimal results, reaction conditions should be carefully controlled:

  • pH 7.0-7.4 (phosphate buffer)

  • Temperature: 37°C

  • Cofactor: Dithiothreitol (DTT, 10-20 mM)

  • Substrate concentration: near Km values (1-5 μM for rT3)

  • Protein amount: 10-50 μg of microsomal protein or 1-5 μg of purified enzyme

  • Incubation time: 30-60 minutes (within linear range)

Activity is typically expressed as pmol of iodide released or product formed per minute per mg protein. Including PTU (100-500 μM) in parallel reactions helps confirm Dio1 specificity, as it selectively inhibits Dio1 but not Dio2 or Dio3 .

How do genetic variations in the Dio1 gene affect enzyme function and thyroid hormone metabolism?

Genetic variations in the Dio1 gene can significantly impact enzyme function and consequently alter thyroid hormone homeostasis. Several single nucleotide polymorphisms (SNPs) have been identified and characterized:

SNP IdentifierNucleotide ChangeEffect on Enzyme FunctionImpact on Thyroid Hormone LevelsClinical Significance
rs12095080A to GReduced catalytic efficiencyAltered T3:T4 ratio, increased rT3Associated with poor outcomes in cardiac patients
rs2235544C to AAltered protein stabilityAffects T3 and rT3 serum levelsInfluences baseline psychological well-being
rs11206244T to CModified regulatory responseChanges in T3:T4 ratioPotential impact on T4 to T3 conversion efficiency

Research has demonstrated that carriers of the rs12095080 AG genotype experienced significantly poorer outcomes in cardiac studies, with a hazard ratio of 4.09 (95% CI = 1.42–11.78; p = 0.009) for mortality . Patients with this heterozygous genotype experienced death approximately 2.5 months earlier compared to AA genotype carriers (19.7 ± 1.0 months vs. 22.2 ± 0.23 months; log-rank χ² = 7.99, p = 0.005) .

These genetic variations appear to affect not only the enzyme's catalytic properties but also its regulation, potentially contributing to individual differences in thyroid hormone metabolism. Understanding these variations is particularly important when studying models of thyroid dysfunction, as they may explain heterogeneity in research findings and treatment responses.

What are the mechanisms of substrate recognition and catalysis in mouse Dio1, and how do they differ from human Dio1?

The mechanisms of substrate recognition and catalysis in Dio1 involve complex interactions between the enzyme's active site, the selenocysteine residue, and the iodothyronine substrates. Comparative studies between mouse and human Dio1 have revealed both conserved features and species-specific differences:

  • Active Site Architecture:

    • Both mouse and human Dio1 contain a critical selenocysteine residue in their active site, encoded by the UGA codon

    • The catalytic pocket is formed by a thioredoxin-like fold that positions the selenocysteine for optimal interaction with substrate

    • Mouse Dio1 exhibits a slightly more constrained substrate binding pocket, potentially contributing to subtle differences in substrate specificity

  • Catalytic Mechanism:

    • Both enzymes follow ping-pong kinetics, where the enzyme first reacts with the iodothyronine substrate, releasing the deiodinated product

    • The resulting selenenyl iodide intermediate is then regenerated to the active form by reaction with the cofactor dithiothreitol (DTT)

    • The rate-limiting step appears to be the regeneration of the active enzyme form

  • Species Differences:

    • Mouse Dio1 exhibits approximately 20-30% higher catalytic efficiency (kcat/Km) for rT3 compared to human Dio1

    • Human Dio1 shows greater substrate promiscuity, effectively deiodinating a wider range of iodothyronine derivatives

    • The half-life of mouse Dio1 protein (approximately 12 hours) is shorter than that of human Dio1 (approximately 18 hours) under similar conditions

    • Mouse Dio1 demonstrates altered sensitivity to certain inhibitors compared to human Dio1, which has implications for experimental design when testing potential thyroid-disrupting compounds

These mechanistic insights are crucial for researchers utilizing mouse models to study thyroid physiology, as they must account for these differences when translating findings to human applications.

What approaches can be used to investigate Dio1 inhibition in toxicological studies?

Investigating Dio1 inhibition is crucial for identifying potential thyroid-disrupting compounds. The following methodological approaches provide rigorous frameworks for such investigations:

  • Standardized DIO1-SK Assay Protocol:
    The DIO1-SK assay has been validated by EU RL ECVAM and provides a standardized approach to testing potential inhibitors . Key methodological elements include:

    • Using microsomal fractions containing Dio1 or recombinant Dio1 enzyme

    • Employing reverse T3 as the preferred substrate

    • Measuring activity through the Sandell-Kolthoff reaction

    • Testing compounds at multiple concentrations (typically 8-10 dilutions)

    • Including positive controls (e.g., propylthiouracil)

    • Performing at least three independent experiments

  • Data Analysis and Interpretation Procedure (DIP):
    Based on validation studies, compounds can be categorized according to :

    • Efficacy: Maximum inhibition >90% (strong inhibitor), 20-90% (partial inhibitor), <20% (non-inhibitor)

    • Potency: IC50 values - High (<1 μM), Moderate (1-10 μM), Low (>10 μM)

    • Not applicable: Compounds showing assay interference

  • Special Considerations:

    • Address potential assay interference through appropriate controls

    • Use compound concentrations that do not exceed solubility limits

    • Consider cytotoxicity in parallel cell-based assays

    • Account for protein binding effects through free concentration measurements

    • Compare results with computational models for mechanistic understanding

A comprehensive assessment in the DIO1-SK assay revealed that among 22 test substances, seven produced maximum DIO1 inhibition >90% (classified as inhibitors) and 11 showed inhibition below 20% (classified as non-inhibiting substances). Two test substances, Ketoconazole and Silichristin, were found to be not applicable based on assay interference . This demonstrates the importance of rigorous methodological approaches to accurately classify compounds based on their Dio1-inhibitory potential.

How should researchers interpret discrepancies between in vitro and in vivo findings in Dio1 functional studies?

Discrepancies between in vitro and in vivo findings are common challenges in Dio1 research. A methodical approach to addressing these discrepancies includes:

  • Systematic Evaluation of Experimental Conditions:

    • Consider differences in cofactor availability (e.g., glutathione, thioredoxin systems)

    • Examine substrate concentrations relative to physiological levels

    • Assess the influence of microenvironmental factors (pH, ionic strength, temperature)

    • Evaluate post-translational modifications present in vivo but absent in vitro

  • Accounting for Compensatory Mechanisms:

    • In vivo, Dio2 may compensate for Dio1 inhibition or deficiency

    • The hypothalamic-pituitary-thyroid axis feedback adjusts TSH and thyroid hormone production

    • Thyroid hormone transporters and receptors may be upregulated or downregulated

    • Changes in thyroid hormone binding proteins alter free hormone availability

  • Integration of Multi-level Data:
    When confronting discrepancies, researchers should:

    • Confirm enzyme expression levels in the target tissues

    • Measure both enzyme activity and protein abundance

    • Assess tissue-specific T3, T4, and rT3 concentrations

    • Consider potential effects of circadian rhythms on deiodinase activity

    • Evaluate the contribution of peripheral versus central thyroid hormone metabolism

  • Translation Framework:
    The following decision matrix can guide interpretation:

    In Vitro FindingIn Vivo FindingPotential ExplanationResearch Approach
    InhibitionNo effectCompensatory mechanisms, poor bioavailabilityTissue-specific analysis, pharmacokinetic studies
    No effectAltered TH levelsIndirect mechanisms, metabolitesMetabolite screening, systems biology approaches
    ActivationHypothyroidismOff-target effects, feedback disruptionPathway analysis, receptor studies
    InhibitionEnhanced effectBioaccumulation, secondary targetsTime-course studies, broad target screening

By systematically addressing these factors, researchers can better understand the biological relevance of their findings and develop more predictive experimental models.

How does Dio1 activity interact with other thyroid hormone metabolic pathways in physiological and pathological conditions?

Dio1 functions within a complex network of thyroid hormone metabolic pathways, with significant crosstalk and regulatory interactions:

  • Integration with Other Deiodinases:
    Dio1, Dio2, and Dio3 exhibit tissue-specific distribution and differential regulation, creating a dynamic system for local and systemic thyroid hormone control:

    Physiological StateDio1 ActivityDio2 ActivityDio3 ActivityNet Effect
    NormalModerateTissue-specificLow in adultsHomeostasis
    HypothyroidismDecreasedIncreasedMinimal changeT3 preservation
    HyperthyroidismIncreasedDecreasedIncreasedT3 clearance
    Illness/FastingDecreasedDecreasedIncreased"Low T3 syndrome"
    DevelopmentLow in fetusTissue-specificHigh in placentaTissue-specific programming

    In pathological conditions like "Low T3 syndrome" observed during critical illness, decreased Dio1 activity combines with increased Dio3 activity, resulting in low circulating T3 levels despite normal or slightly decreased TSH .

  • Interaction with Sulfotransferases and Glucuronidases:
    Dio1 preferentially deiodinates sulfated iodothyronines, creating an important interaction with sulfotransferases:

    • Sulfation by SULT enzymes inactivates T3 but creates preferred substrates for Dio1

    • Glucuronidation promotes biliary excretion, reducing substrate availability for Dio1

    • During fetal development and illness, changes in sulfation pathways significantly impact Dio1-mediated metabolism

  • Cross-regulation with Nuclear Receptor Signaling:
    Thyroid hormone receptors (TRs) and other nuclear receptors both influence and are influenced by Dio1 activity:

    • T3 upregulates Dio1 expression through TR binding to TREs in the Dio1 promoter

    • Peroxisome proliferator-activated receptor (PPAR) activation modulates Dio1 expression

    • Dio1-generated T3 activates local TR signaling in a feed-forward mechanism

  • Pathological Significance:
    In various diseases, the interaction between Dio1 and other pathways becomes particularly important:

    • In thyroid cancer, altered Dio1 expression contributes to tumor-specific T3 generation

    • In liver diseases, impaired Dio1 activity contributes to systemic thyroid hormone abnormalities

    • In diabetes mellitus, insulin regulation of Dio1 becomes dysregulated, affecting thyroid status

    • In genetic Dio1 deficiencies, compensatory upregulation of Dio2 may occur in specific tissues

Understanding these complex interactions is essential for interpreting experimental results and developing targeted therapeutic approaches for thyroid disorders.

What are the latest techniques for studying Dio1 regulation at the transcriptional, post-transcriptional, and post-translational levels?

Research into Dio1 regulation has advanced significantly with the development of sophisticated molecular techniques. The following methodological approaches represent current state-of-the-art techniques for investigating regulatory mechanisms:

  • Transcriptional Regulation Studies:

    • ChIP-seq (Chromatin Immunoprecipitation Sequencing): Identifies TR, RXR, and other transcription factor binding sites in the Dio1 promoter and enhancers

    • CRISPR-based transcriptional modulation: CRISPR-activation (CRISPRa) and CRISPR-interference (CRISPRi) systems allow targeted manipulation of Dio1 transcription

    • Single-cell transcriptomics: Reveals cell-type-specific Dio1 expression patterns and transcriptional responses

    • Massively Parallel Reporter Assays (MPRAs): Enables functional testing of thousands of Dio1 promoter/enhancer variants simultaneously

  • Post-transcriptional Regulation Approaches:

    • CLIP-seq (Cross-linking Immunoprecipitation Sequencing): Maps RNA-protein interactions affecting Dio1 mRNA stability and translation

    • Ribosome profiling: Provides genome-wide information on translation efficiency of Dio1 mRNA

    • RNA structure probing: Methods like SHAPE-seq reveal structural elements in Dio1 mRNA that influence regulation

    • miRNA-target identification: Techniques such as CLASH (cross-linking, ligation, and sequencing of hybrids) identify miRNAs directly interacting with Dio1 mRNA

  • Post-translational Regulation Methods:

    • Mass spectrometry-based proteomics: Identifies phosphorylation, ubiquitination, and other modifications on Dio1 protein

    • Proximity labeling proteomics (BioID, APEX): Maps the Dio1 protein interaction network in living cells

    • FRET/BRET-based biosensors: Monitors real-time conformational changes in Dio1 structure upon regulation

    • Protein turnover assays: Pulse-chase experiments with stable isotope labeling reveal Dio1 protein half-life under different conditions

  • Integrative Systems Biology Approaches:

    • Multi-omics integration: Combines transcriptomics, proteomics, and metabolomics data to build comprehensive regulatory models

    • Mathematical modeling: Develops predictive models of Dio1 activity based on multiple regulatory inputs

    • Tissue-specific conditional knockout models: CRISPR-engineered mouse models with inducible, tissue-specific Dio1 deletion

    • Organoid and microphysiological systems: Studies Dio1 regulation in complex 3D tissue environments that better recapitulate in vivo conditions

These advanced techniques are providing unprecedented insights into the multilayered regulation of Dio1, revealing potential therapeutic targets and explaining tissue-specific differences in enzyme activity under various physiological and pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.