Recombinant Mouse TYRO protein tyrosine kinase-binding protein (Tyrobp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage condition, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tyrobp; Dap12; Karap; TYRO protein tyrosine kinase-binding protein; DNAX-activation protein 12; Killer-activating receptor-associated protein; KAR-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-114
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
LSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR
Uniprot No.

Target Background

Function
TYROBP (Tyrosine kinase-binding protein) is an adapter protein that non-covalently associates with activating receptors found on the surface of various immune cells. These receptors mediate signaling and cell activation upon ligand binding. Following ligand binding by the associated receptors, TYROBP undergoes tyrosine phosphorylation within its ITAM (immunoreceptor tyrosine-based activation motif) domain, triggering the activation of additional tyrosine kinases and subsequent cell activation. TYROBP also plays an inhibitory role in some cells. It associates with activating receptors of the CD300 family to mediate cell activation and with activating receptors of the CD200R family to achieve the same effect. TYROBP is essential for neutrophil activation mediated by integrin and for the activation of myeloid cells mediated by the CLEC5A/MDL1 receptor. It associates with natural killer (NK) cell receptors, such as the KLRD1/KLRC2 heterodimer, to mediate NK cell activation and also associates non-covalently with the NK cell receptors KLRA4/LY49D and KLRA8/LY49H, leading to NK cell activation. TYROBP associates with TREM1 to mediate the activation of neutrophils and monocytes and with TREM2 on monocyte-derived dendritic cells to mediate up-regulation of chemokine receptor CCR7, dendritic cell maturation, and survival. Association with TREM2 facilitates cytokine-induced formation of multinucleated giant cells through macrophage fusion. TYROBP stabilizes the TREM2 C-terminal fragment (TREM2-CTF) resulting from TREM2 ectodomain shedding. In microglia, TYROBP is required, along with TREM2, for phagocytosis of apoptotic neurons. It is also required with ITGAM/CD11B in microglia to control the production of microglial superoxide ions, which promote neuronal apoptosis during brain development. TYROBP promotes proinflammatory responses in microglia following nerve injury, accelerating degeneration of injured neurons. It positively regulates the expression of the IRAK3/IRAK-M kinase and IL10 production by liver dendritic cells, inhibiting their T cell allostimulatory ability. TYROBP negatively regulates B cell proliferation. It is required for CSF1-mediated osteoclast cytoskeletal organization and positively regulates multinucleation during osteoclast development.
Gene References Into Functions
  1. Research has identified modulatory effects of TYROBP deficiency on the level of TAU phosphorylation, accompanied by a reduction in the severity of neuritic dystrophy. TYROBP deficiency also altered the expression of various Alzheimer's disease (AD)-related genes, including Cd33. Electrophysiological abnormalities and learning behavior deficits associated with APP/PSEN1 transgenes were significantly attenuated on a Tyrobp-null background. PMID: 28612290
  2. These findings demonstrate that PTX (Pertussis toxin) targets the innate immune system through DAP12, FcRgamma, and MyD88, providing valuable insights into the immunobiology of PTX. PMID: 28089363
  3. Recent studies have revealed that activated microglia in the spinal dorsal horn exacerbate neuropathic pain, suggesting that suppressing microglial activity should be considered a therapeutic target. However, few molecules have been identified as regulators of microglial activity. This study focused on the receptor complex of TREM2 and DAP12, both of which are expressed by microglia and have been implicated in PMID: 27798193
  4. In vitro studies demonstrate that TNF/IL-6 generated osteoclasts that resorbed mineralized tissue through a pathway dependent on IL-6R, NFATc1, DNAX-activation protein 12, and cell proliferation. PMID: 27563728
  5. The findings suggest that DAP12 acts as a brake on the pulmonary immune response to C. neoformans by promoting pulmonary eosinophilia and inhibiting the activation and antifungal activities of effector cells, including NK cells and macrophages. PMID: 27068093
  6. DAP12 plays a significant role in the initial inflammatory response, bone remodeling, and regeneration. PMID: 26030755
  7. Microglial activation following axotomy, mediated by DAP12, promotes pro-inflammatory responses and accelerates nerve injury-induced neuron death. PMID: 25690660
  8. These results support a role of DAP12 in stabilizing TREM2-CTF, thereby protecting against excessive pro-inflammatory responses. PMID: 25957402
  9. This research reveals a previously unrecognized role for DAP12 expression in tissue-resident alveolar macrophages in mediating acute noninfectious tissue injury through regulation of neutrophil trafficking. PMID: 25762783
  10. DAP12 expression in liver grafts regulates donor mDC (migratory dendritic cell) migration to host lymphoid tissue, alloreactive T cell responses, and transplant tolerance. PMID: 24935196
  11. Integrin alphav beta3/Dap12 double-deficient mice developed profound osteoporosis. PMID: 25547154
  12. This study identifies the DAP12/IRAK-M/IL-10 pathway as a novel molecular pathway in APCs (antigen-presenting cells) exploited by mycobacterial pathogens, allowing infection a foothold in the lung. PMID: 24172845
  13. We conclude that DAP12, possibly through association with TREM1/3, is involved in renal inflammation during the progression of unilateral ureter obstruction. PMID: 24358193
  14. Siglec-15 regulates osteoclast development and bone resorption by modulating RANKL (receptor activator of nuclear factor kappaB ligand) signaling in association with DAP12. PMID: 23677868
  15. Dap12- and FcRgamma-deficiency exacerbates Granulocyte-Macrophage Colony-Stimulating Factor-driven monocyte differentiation and production of inflammatory monocyte-derived dendritic cells. PMID: 24155889
  16. The effects of DAP12 deficiency on the development of autoimmune uveitis are dramatically affected by environmental factors. PMID: 23906311
  17. DOK3 physically associated with the ITAM of DAP12 through its phosphotyrosine-binding domain. In response to LPS, DOK3 was phosphorylated in a DAP12- and Src-dependent manner, leading to translocation of phosphorylated DOK3 to the plasma membrane. PMID: 23962980
  18. DAP12 is involved in microglia-induced dopaminergic neuron cell death in an in vitro model of Parkinson's disease. PMID: 23844828
  19. The Siglec-15-DAP12-Syk-signaling cascade plays a critical role in functional osteoclast formation. PMID: 22451653
  20. Because mouse and rat NKG2C and -E transmembrane regions contain a positively charged arginine residue located close to the extracellular surface, these receptors may not associate with DAP12. PMID: 22084441
  21. This study reports that the emergence of immunopathogenic CD4 T cells is under the control of a transmembrane immunoadaptor DAP12 pathway during influenza infection. PMID: 21908731
  22. Data suggest that OSCAR is a collagen receptor that binds to specific collagen motifs and costimulates osteoclastogenesis in DAP12-deficient humans and mice. PMID: 21841309
  23. DAP12-coupled MAIR-II negatively regulates B cell-mediated adaptive immune responses. PMID: 21727189
  24. A regulatory role is highlighted for DAP12 in hepatic dendritic cell maturation; a mechanism via interleukin-1 receptor-associated kinase 3 (IRAK-M) is suggested whereby this function may be induced and maintained. PMID: 21257958
  25. Cytoskeletal dysfunction, rather than arrested differentiation, is the dominant consequence of DAP12 deficiency in osteoclasts. PMID: 20720152
  26. This research demonstrates a previously uncharacterized interaction of SHIP1 with DAP12, limiting TREM2- and DAP12-dependent signaling, and identifies a mechanism through which SHIP1 regulates key ITAM-containing receptors by blocking the binding and activation of PI3K. PMID: 20484116
  27. These findings indicate that DAP12, possibly through association with TREM2, contributes to alveolar macrophage chemotaxis and recruitment to the lung, potentially mediating macrophage accumulation in lung diseases such as emphysema. PMID: 20421649
  28. The DAP12-associating lectin (MDL)-1 receptor is a key regulator of synovial injury and bone erosion in autoimmune joint inflammation. PMID: 20212065
  29. DAP12 and mature lymphocytes act synergistically to maintain normal bone mass, while playing similar but not synergistic roles in protecting bone loss after gonadal failure. PMID: 17611620
  30. This research highlights a crucial role for a specific activating signaling pathway, in this case, the one induced through KARAP/DAP12, in NK cell-mediated resistance to infection. PMID: 11927627
  31. Aberrant DAP12 signaling in the 129 strain of mice has implications for the analysis of gene-targeted mice. PMID: 12165492
  32. Selective associations with DAP12 determine stimulatory versus costimulatory activity of NKG2D. PMID: 12426565
  33. DAP12 plays a role in signal transduction, bone modeling, and brain myelination [review]. PMID: 12569153
  34. DAP12 contributes to preventing synaptic degeneration, impaired prepulse inhibition, and aberrant electrophysiological profiles in the thalami. PMID: 12569157
  35. Stimulation of the DAP12 adapter protein plays a significant role in the formation of multinuclear osteoclasts, suggesting that DAP12 and its associated receptors participate in regulating bony remodeling. PMID: 14969392
  36. DAP12 and FcRgamma have overlapping roles in supporting osteoclast development in osteoblast-osteoclast cocultures, mirroring their overlapping functions in vivo. PMID: 15073337
  37. DAP12 and its associated molecules are differentially regulated by mycobacterial infection and type 1 cytokines. PMID: 15102754
  38. IL-4-mediated dendritic cell (DC)-activated natural killer (NK) signaling is suppressed in vitro by KARAP/DAP12. PMID: 15128777
  39. KARAP/DAP12-mediated signals play a crucial role in regulating both brain and bone homeostasis, as observed in loss-of-function mice. PMID: 15632019
  40. This research highlights the importance of Fcgr3/Cd3z, Hcst, and Tyrobp in the activation of NK cells in the uterus of pregnant mice. PMID: 15878887
  41. One or more DAP12-pairing receptors negatively regulate signaling through TLRs (Toll-like receptors). PMID: 15895090
  42. DAP12 plays a role in mediating effector function in an NKG2D-dependent and major histocompatibility complex-independent manner. PMID: 16169855
  43. Consistent and selective association of the IDO-competent phenotype with down-modulation of the Tyrobp gene. PMID: 16339401
  44. Plexin-A1 associates with the triggering receptor expressed on myeloid cells-2 (Trem-2), linking semaphorin-signaling to the immuno-receptor tyrosine-based activation motif (ITAM)-bearing adaptor protein, DAP12. PMID: 16715077
  45. DAP12 must associate with a receptor present in the macrophage to inhibit Toll-like receptor- and Fc receptor-induced tumor necrosis factor (TNF) production. PMID: 16887962
  46. DAP12 signaling in plasmacytoid dendritic cells (pDC) can mediate different regulatory effects on their functions, depending on the mechanisms of pDC activation. PMID: 16920926
  47. Ly49H signaling through DAP12 appears to directly augment NK cell sensitivity to low concentrations of proproliferative cytokines such as IL-15. PMID: 17015680
  48. This review discusses the dual functionality of DAP12 and presents evidence that DAP12 can suppress as well as activate natural killer (NK) cells. PMID: 17100880
  49. FcRgamma chain may provide cooperation with and/or compensation for DAP12 in MAIR-II-mediated inflammatory responses by peritoneal macrophages. PMID: 17202337

Show More

Hide All

Database Links
Protein Families
TYROBP family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on microglia (at protein level). Expressed on oligodendrocytes (at protein level). Expressed on macrophages and osteoclasts. Expressed on dendritic cells in liver, spleen, kidney and lung with highest levels in liver dendritic cells.

Q&A

What is the basic structure and function of mouse TYROBP?

Mouse TYROBP is a transmembrane signaling polypeptide containing an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. It functions as an adaptor protein that associates with various cell surface receptors, particularly in immune cells. TYROBP (also known as DAP12) acts as an activating signal transduction element, binding to proteins such as zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) to facilitate downstream signaling cascades. This protein plays crucial roles in signal transduction, bone modeling, brain myelination, and inflammation regulation .

Which signaling pathways involve TYROBP in mouse models?

TYROBP participates in multiple signaling pathways including natural killer cell-mediated cytotoxicity and osteoclast differentiation. In the natural killer cell pathway, TYROBP interacts with proteins such as ICAM2, MAP2K1, IFNA21, IFNB1, and others to regulate cytotoxic immune responses. The protein forms complexes with cell surface receptors like triggering receptor expressed on myeloid cells 1 (TREM1), activating downstream signaling cascades that regulate immune cell function . TYROBP-positive cells also show significant expression of transcription factors including FOS, FOSB, HES1, and JUNB, indicating its role in gene expression regulation .

What are the key differences between mouse and human TYROBP?

While mouse and human TYROBP share significant structural and functional similarities as transmembrane adaptor proteins with ITAM domains, there are species-specific differences in expression patterns, interaction partners, and tissue distribution. Both function in similar signaling pathways including immune cell activation and myeloid cell function. When designing cross-species experiments, researchers should consider that while the core functions are conserved, the nuances in signaling networks and regulatory mechanisms may differ, potentially affecting the translational relevance of mouse model findings to human applications .

What are the optimal methods for detecting mouse TYROBP expression in tissue samples?

For detecting mouse TYROBP in tissue samples, researchers should consider multiple complementary approaches:

  • ELISA assays: Sandwich ELISA using double antibody techniques can detect mouse TYROBP with high sensitivity (approximately 9.375 pg/ml) and a detection range of 15.625-1000 pg/ml .

  • Immunohistochemistry/Immunofluorescence: For tissue localization, use validated antibodies against mouse TYROBP with appropriate positive and negative controls.

  • Western blotting: For protein expression analysis with antibodies specific to mouse TYROBP.

  • qRT-PCR: For quantifying TYROBP mRNA levels in different tissues or experimental conditions.

When working with brain tissues, consider specific sample preparation techniques to preserve membrane protein integrity. For optimal results, validate antibody specificity with TYROBP-knockout tissues as negative controls and compare multiple detection methods to confirm findings .

How should researchers design TYROBP knockout or knockdown experiments in mouse models?

When designing TYROBP knockout or knockdown experiments:

  • Complete knockout approach: Consider using CRISPR/Cas9 to generate whole-organism TYROBP knockout mice, but be aware that this may affect multiple cellular systems simultaneously.

  • Conditional knockout strategy: Use Cre-Lox systems for cell-type specific deletion (e.g., microglia-specific TYROBP knockout) when studying tissue-specific functions.

  • Temporal control considerations: Employ inducible knockout systems when studying developmental versus adult functions of TYROBP.

  • Alternative approaches: For acute studies, consider siRNA or shRNA-mediated knockdown in primary cells or cell lines.

Research has demonstrated that TYROBP gene knockout in microglia significantly reduces interaction with other cell types and decreases neuronal cell apoptosis rates in neuroinflammatory models . When interpreting knockout experiment results, consider potential compensatory mechanisms and indirect effects on interacting signaling pathways.

What are the best practices for producing and validating recombinant mouse TYROBP?

For producing and validating recombinant mouse TYROBP:

  • Expression systems:

    • Mammalian expression (HEK293 cells) provides proper post-translational modifications

    • E. coli systems offer higher yield but may lack proper folding and modifications

    • Consider different fusion tags (His, Flag, Fc, DDK, Myc, GST, SUMO) based on experimental needs

  • Validation methods:

    • Verify protein identity via mass spectrometry

    • Confirm functionality through binding assays with known partners like TREM2

    • Assess purity using SDS-PAGE (>95% purity recommended)

    • Test bioactivity in cell-based assays relevant to TYROBP signaling

  • Storage and handling:

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

    • Include stabilizing agents appropriate for downstream applications

    • Validate recombinant protein stability over time with activity assays

Proper glycosylation and tertiary structure are critical for TYROBP function, so verification of these properties is essential before experimental use.

How does TYROBP function in microglia, and what are the implications for neuroinflammation studies?

TYROBP functions as a crucial signaling adaptor in microglia, mediating interactions between these cells and neurons during inflammatory responses. When studying neuroinflammation:

  • Signaling mechanism: TYROBP forms complexes with microglial cell surface receptors like TREM2, activating downstream tyrosine kinase signaling cascades that regulate microglial activation states, phagocytosis, and cytokine production.

  • Neuroprotective vs. neurotoxic effects: Research shows that TYROBP gene knockout in microglia significantly reduces harmful neuronal interactions and decreases neuronal cell apoptosis rates in inflammatory conditions, suggesting a potential role in mediating neurotoxicity .

  • Experimental design considerations: When studying microglial TYROBP, researchers should account for:

    • Microglial activation states (M1/M2 paradigm)

    • Temporal dynamics of TYROBP expression following inflammatory stimuli

    • Region-specific differences in microglial TYROBP functions

    • Interactions with other cell types (neurons, astrocytes, oligodendrocytes)

  • Methodological approaches: Co-culture systems of microglia with neurons or organotypic slice cultures can help elucidate the specific contributions of microglial TYROBP to neuroinflammatory processes.

Understanding TYROBP function in microglia is essential for developing targeted therapies for neuroinflammatory conditions, though contradictory results in the literature suggest context-dependent functions requiring careful experimental design .

What role does TYROBP play in neurodegenerative disease models, and how should experiments be designed to study this?

TYROBP plays significant roles in neurodegenerative disease pathology, with research implications for multiple conditions:

  • Nasu-Hakola disease/PLOSL: Mutations in TYROBP have been directly linked to this rare neurodegenerative disorder affecting both brain and bones. Mouse models with corresponding mutations can serve as valuable tools for studying disease mechanisms .

  • Alzheimer's disease models: TYROBP has been implicated in Alzheimer's pathogenesis through its role in microglial function. When designing experiments:

    • Consider age-dependent changes in TYROBP expression

    • Examine interactions with amyloid-β and tau pathology

    • Assess cognitive outcomes alongside molecular changes

    • Compare findings across multiple AD mouse models to ensure robustness

  • Experimental approaches:

    • Conditional knockout strategies targeting specific brain regions

    • Temporal manipulation of TYROBP expression at different disease stages

    • Combination with other disease-relevant genetic modifications

    • Cross-sectional and longitudinal studies to capture disease progression

  • Outcome measures:

    • Behavioral assessments (cognitive, motor function)

    • Histopathological analysis of neurodegeneration and protein aggregation

    • Neuroinflammatory markers and microglial activation states

    • Transcriptomic/proteomic profiling of affected regions

When interpreting results, researchers should consider that TYROBP function may vary across different cell types and neurological conditions, potentially explaining contradictory findings in the literature .

How does TYROBP interact with TREM2 in mouse models, and what are the implications for studying neurological disorders?

The TYROBP-TREM2 interaction represents a critical signaling axis in neurological disorders:

  • Molecular interaction: TYROBP functions as an essential adaptor protein for TREM2, a cell surface receptor primarily expressed on microglia. This interaction is critical for proper TREM2 signaling, with both proteins associated with the same disease (PLOSL/Nasu-Hakola disease) .

  • Functional consequences: The TYROBP-TREM2 complex regulates:

    • Microglial phagocytosis of cellular debris and protein aggregates

    • Inflammatory responses in the CNS

    • Microglial survival and proliferation

    • Lipid sensing and metabolic functions

  • Experimental approaches:

    • Co-immunoprecipitation studies to confirm physical interaction

    • Proximity ligation assays for visualizing interactions in situ

    • Comparative phenotyping of single vs. double knockout models

    • Structure-function analyses using domain-specific mutations

  • Disease relevance: While mutations in either gene can cause PLOSL, they may contribute differently to other conditions like Alzheimer's disease. Research should explore both shared and distinct pathways affected by TYROBP vs. TREM2 disruption .

When designing experiments to study this interaction, consider that TYROBP can partner with multiple receptors beyond TREM2, necessitating careful interpretation of knockout phenotypes and potential compensatory mechanisms.

How does TYROBP expression in endothelial cells affect tumor microenvironment interactions?

TYROBP-positive endothelial cells (ECs) play significant roles in tumor microenvironment interactions:

  • Tumor-EC crosstalk: TYROBP-positive ECs exhibit the strongest crosstalk with malignant cells compared to other EC subtypes, likely mediated through TWEAK (TNF-like weak inducer of apoptosis), a multifunctional cytokine .

  • Immune landscape influence: Tumors with high enrichment of TYROBP-positive ECs demonstrate:

    • Increased numbers of activated CD4+ T cells, CD8+ T cells, and natural killer cells

    • Higher immune scores indicative of "hot" tumor states

    • Elevated expression of classical immune checkpoint inhibitors including CD276 and CD274

    • Activated chemokine, T cell receptor, B cell receptor, and Nod-like receptor signaling pathways

  • Experimental approaches:

    • Single-cell RNA sequencing to identify TYROBP-positive EC populations

    • Spatial transcriptomics to map EC-tumor cell interactions in situ

    • Flow cytometry to quantify immune cell infiltration patterns

    • Co-culture systems to model EC-tumor cell communication

  • Prognostic significance: TYROBP-positive EC enrichment correlates with immunological status and serves as an independent prognostic factor in multiple cancer types .

This evidence suggests TYROBP-positive ECs may represent a valuable therapeutic target for modulating tumor immune microenvironments, particularly in converting "cold" tumors to "hot" immunologically responsive tumors .

What methodologies are most appropriate for investigating TYROBP's role in natural killer cell function?

For investigating TYROBP's role in natural killer (NK) cell function:

  • Primary cell isolation and culture systems:

    • Isolate primary mouse NK cells from spleen or bone marrow

    • Use IL-2 or IL-15 for expansion while maintaining physiological relevance

    • Compare TYROBP knockout NK cells with wild-type controls

    • Consider co-culture systems with target cells to assess functional outcomes

  • Functional assays:

    • Cytotoxicity assays against standard target cells (e.g., YAC-1)

    • Cytokine production measurement (IFN-γ, TNF-α)

    • Receptor clustering and synapse formation analysis

    • Ca²⁺ flux assays to assess activation signaling

  • Molecular analyses:

    • Phosphoproteomic analysis of downstream signaling

    • Interaction studies with various NK cell receptors

    • Analysis of ITAM motif phosphorylation states

    • Receptor complex formation using proximity ligation assays

  • In vivo models:

    • NK cell-specific conditional TYROBP knockout mice

    • Adoptive transfer of TYROBP-deficient NK cells into tumor models

    • Viral challenge models to assess NK-mediated immune responses

TYROBP is involved in the natural killer cell-mediated cytotoxicity pathway, interacting with proteins such as ICAM2, MAP2K1, IFNA21, and others that regulate cytotoxic immune responses . This positions it as a central regulator of NK cell function worthy of detailed investigation.

How should researchers interpret correlations between TYROBP expression and immune checkpoint molecules in cancer models?

When interpreting correlations between TYROBP expression and immune checkpoint molecules:

  • Data interpretation framework:

    • Distinguish between correlation and causation through mechanistic studies

    • Consider cell type-specific expression patterns (tumor cells vs. immune cells vs. stromal cells)

    • Evaluate whether TYROBP is driving immune checkpoint expression or vice versa

    • Assess how tumor type and stage affect these correlations

  • Key experimental approaches:

    • Single-cell RNA-seq to deconvolute cellular sources of expression

    • Spatial transcriptomics to map co-expression patterns in tumor sections

    • TYROBP manipulation studies to determine effects on checkpoint expression

    • Clinical sample analysis correlating TYROBP with treatment response

  • Research findings to consider:

    • TYROBP-positive endothelial cells show high expression of immune checkpoints including LAG3, CD48, PDCD1LG2, CD244, SLAMF7, and HAVCR2

    • Patients with high TYROBP-positive EC enrichment show increased expression of classical checkpoint inhibitors like CD276 and CD274

    • These correlations are associated with a "hot" tumor immune microenvironment with activated T cells and natural killer cells

  • Translational implications:

    • TYROBP expression may serve as a biomarker for immunotherapy response

    • Combined targeting of TYROBP and immune checkpoints might enhance therapeutic efficacy

    • Understanding these correlations could help stratify patients for immunotherapy trials

This correlation suggests TYROBP may be involved in regulating immune evasion mechanisms, making it a potential target for enhancing immunotherapy efficacy .

What bioinformatic approaches are recommended for analyzing TYROBP-centered protein-protein interaction networks?

For analyzing TYROBP-centered protein-protein interaction networks:

  • Network construction methods:

    • STRING database integration with a combined score >0.4 for statistical significance

    • Cytoscape visualization (Version 3.7.2 or later) for network representation

    • Molecular Complex Detection (MCODE) plug-in for screening hub modules (recommended parameters: MCODE score=5, degree=2, Node score cut-off=0.2, K-score=2, Max. Depth=100)

    • Functional annotation using tools like DAVID to contextualize network components

  • Co-expression analysis approaches:

    • Weighted Gene Co-expression Network Analysis (WGCNA) for identifying gene modules correlated with clinical traits

    • Recommended settings: power β=4, minimum module size=30 for standard scale-free networks

    • Topological Overlap Matrix (TOM) conversion for adjacency measurements

    • Hierarchical clustering to classify genes with high absolute correlation

  • Hub gene identification:

    • CytoHubba (Version 0.1) plug-in utilization with the Degree method

    • Selection of top 30 ranked genes in hub modules as candidates

    • Cross-validation across multiple datasets and experimental systems

    • Integration of network analysis with experimental validation

  • Validation strategies:

    • Expression correlation analysis across independent datasets

    • Functional validation of predicted interactions

    • Comparison with established pathway databases

    • Integration with clinical outcome data when available

This systematic approach has successfully identified TYROBP as a key gene with prognostic value in gastric cancer through network analysis, demonstrating its utility .

How can researchers resolve contradictory data regarding TYROBP functions across different experimental models?

To resolve contradictory data regarding TYROBP functions:

  • Systematic comparison framework:

    • Create a comprehensive table comparing experimental models, conditions, and outcomes

    • Categorize contradictions by cell type, disease model, and methodology

    • Identify pattern dependencies on experimental variables

  • Critical experimental variables to consider:

    • Cell/tissue type specificities: TYROBP function varies significantly across cell types

    • Developmental stage and temporal dynamics of expression

    • Acute vs. chronic manipulation models

    • Species differences (mouse vs. human systems)

    • Disease context and inflammatory state

  • Methodological reconciliation approaches:

    • Direct side-by-side comparison studies using standardized protocols

    • Utilization of multiple complementary techniques to verify findings

    • Single-cell analysis to resolve cell population heterogeneity

    • Careful consideration of knockout/knockdown efficiency and specificity

  • Collaborative efforts:

    • Multi-laboratory validation using identical reagents and protocols

    • Data sharing through repositories with detailed methodological documentation

    • Meta-analysis of published results with attention to methodological differences

Research on TYROBP in traumatic brain injury (TBI) exemplifies these challenges, with contradictory results possibly due to different experimental models, sample sizes, and disease complexity . Understanding that TYROBP function varies across cell types and neurological conditions is crucial for interpreting seemingly conflicting data.

What statistical methods are most appropriate for analyzing correlations between TYROBP expression and clinical outcomes?

For analyzing correlations between TYROBP expression and clinical outcomes:

  • Survival analysis techniques:

    • Kaplan-Meier survival analysis with log-rank test for comparing high vs. low TYROBP expression groups

    • Cox proportional hazards regression for multivariate analysis including TYROBP and other clinicopathological variables

    • LASSO regression for selecting optimal gene signatures incorporating TYROBP

    • Time-dependent ROC analysis to evaluate prognostic performance

  • Predictive modeling approaches:

    • Nomogram construction based on clinical variables and TYROBP-based risk scores

    • Calibration curve analysis to assess agreement between predicted and actual outcomes

    • Clinical impact curve assessment to demonstrate clinical benefit

    • Risk stratification models incorporating TYROBP expression

  • Correlation analysis methods:

    • Spearman or Pearson correlation for continuous variables

    • Point-biserial correlation for dichotomous outcomes

    • Partial correlation to control for confounding variables

    • Multiple testing correction (e.g., Benjamini-Hochberg) for genome-wide analyses

  • Validation strategies:

    • Training-validation set approach (e.g., 70:30 split)

    • Cross-validation techniques (k-fold, leave-one-out)

    • External validation in independent cohorts

    • Bootstrap resampling for confidence interval estimation

Research has demonstrated that TYROBP expression correlates with clinical outcomes in multiple cancer types, with high expression associated with worse prognosis in breast cancer and serving as an independent prognostic factor in gastric cancer .

How can TYROBP-centered research inform therapeutic development for neurodegenerative diseases?

TYROBP-centered research offers several pathways to therapeutic development for neurodegenerative diseases:

  • Modulation of microglial activation:

    • TYROBP inhibition strategies could potentially reduce harmful microglial activation in neurodegenerative contexts

    • Research shows TYROBP gene knockout in microglia reduces neuronal cell apoptosis rates, suggesting neuroprotective potential

    • Therapeutic approaches could include small molecule inhibitors of TYROBP signaling or antibodies disrupting TYROBP-receptor interactions

  • Targeting the TYROBP-TREM2 axis:

    • Both TYROBP and its receptor TREM2 are associated with Nasu-Hakola disease, suggesting this pathway as a therapeutic target

    • Enhancing beneficial TREM2-TYROBP signaling could promote microglial phagocytosis of protein aggregates

    • Dampening excessive TYROBP-mediated inflammation while preserving homeostatic functions represents a key challenge

  • Personalized medicine approaches:

    • TYROBP mutations and expression changes could serve as biomarkers for patient stratification

    • Individual variations in TYROBP signaling networks might predict response to immunomodulatory therapies

    • Genetic screening for TYROBP variants could identify at-risk populations for preventive interventions

  • Cross-disease applications:

    • Insights from TYROBP's role in Alzheimer's disease could inform approaches to other neurodegenerative conditions

    • The protein's involvement in both neurological and immunological processes suggests potential for broad therapeutic applications

    • Understanding TYROBP's brain-specific functions versus systemic roles is critical for targeted intervention design

The complex and sometimes contradictory findings regarding TYROBP function across different experimental models highlight the importance of context-specific therapeutic approaches .

What are the most promising approaches for investigating TYROBP's role in tumor immunology and potential immunotherapy applications?

For investigating TYROBP's role in tumor immunology and immunotherapy applications:

  • Tumor microenvironment analysis:

    • Single-cell RNA sequencing to identify TYROBP-expressing cell populations within tumors

    • Spatial transcriptomics to map TYROBP+ cells in relation to tumor and immune cell locations

    • CyTOF or spectral flow cytometry to characterize TYROBP+ cell phenotypes

    • 3D tumor organoid models incorporating TYROBP-expressing stromal components

  • Functional manipulation studies:

    • Cell type-specific TYROBP knockout/knockdown in tumor models

    • TYROBP overexpression systems to assess gain-of-function effects

    • Receptor-ligand blocking experiments to disrupt TYROBP-mediated signaling

    • Ex vivo tumor slice cultures to test TYROBP-targeting interventions

  • Immunotherapy combination strategies:

    • Testing TYROBP modulation in combination with immune checkpoint inhibitors

    • Evaluating effects on converting "cold" to "hot" tumor immune environments

    • Examining synergy with other immunomodulatory approaches

    • Developing biomarkers for patient stratification based on TYROBP expression profiles

  • Translational biomarker development:

    • TYROBP-positive endothelial cell quantification as a prognostic marker

    • Correlation of TYROBP expression with immune checkpoint molecules (LAG3, CD48, PDCD1LG2)

    • Development of imaging agents targeting TYROBP+ cells in tumors

    • Liquid biopsy approaches to monitor TYROBP-expressing circulating cells

Research has shown that TYROBP-positive endothelial cells exhibit significant communication with malignant cells and are associated with increased immune cell infiltration, suggesting potential for therapeutic targeting to enhance immunotherapy efficacy .

What advanced genetic engineering approaches might be applied to study TYROBP function in complex disease models?

Advanced genetic engineering approaches for studying TYROBP in complex disease models include:

  • Spatiotemporal control systems:

    • Inducible Cre-loxP systems with cell type-specific promoters

    • Optogenetic control of TYROBP expression or function

    • Chemical-genetic approaches for rapid, reversible protein regulation

    • AAV-mediated regional gene delivery for targeted brain region studies

  • Multi-gene manipulation strategies:

    • CRISPR multiplexing to simultaneously target TYROBP and interacting partners

    • Creation of humanized mouse models expressing human TYROBP variants

    • Knock-in of specific disease-associated mutations (e.g., Nasu-Hakola mutations)

    • Combinatorial genetic approaches modeling complex genetic risk factors

  • In vivo monitoring technologies:

    • TYROBP reporter mouse lines for real-time visualization of expression

    • Intravital microscopy techniques to observe TYROBP+ cell dynamics

    • Inducible tagging systems for lineage tracing TYROBP-expressing cells

    • Proximity labeling approaches (BioID, APEX) to map dynamic protein interactions

  • Precision disease modeling:

    • Patient-derived xenograft models with human immune components

    • Humanized immune system mice to study species-specific TYROBP functions

    • Precision genome editing to introduce exact patient mutations

    • Organoid models incorporating TYROBP-expressing immune cells

These approaches can help resolve the complexity of TYROBP function across different cell types and disease contexts, potentially explaining contradictory results in current literature and advancing understanding of this protein's diverse roles in health and disease .

What are the emerging questions regarding TYROBP's role across different biological systems?

Emerging research questions for TYROBP investigation include:

  • Cell type-specific functions:

    • How does TYROBP signaling differ between microglia, endothelial cells, and peripheral immune cells?

    • What determines the contextual outcome of TYROBP activation across different tissues?

    • How do cell-specific TYROBP interaction networks influence functional outcomes?

    • What is the developmental trajectory of TYROBP-expressing cells in different organ systems?

  • Disease pathogenesis mechanisms:

    • What explains TYROBP's seemingly contradictory roles in different disease contexts?

    • How does TYROBP contribute to both protective and pathological immune responses?

    • What is the mechanistic link between TYROBP mutations and the development of Nasu-Hakola disease?

    • How does TYROBP contribute to the diverse pathologies in neurodegenerative disorders versus cancer?

  • Regulatory networks:

    • What transcriptional and post-translational mechanisms regulate TYROBP expression?

    • How does TYROBP influence genome-wide expression patterns in different cell types?

    • What feedback mechanisms control TYROBP signaling intensity and duration?

    • How do environmental factors modulate TYROBP function in health and disease?

  • Evolutionary perspectives:

    • How is TYROBP function conserved across species, and what can this tell us about its essential roles?

    • What selective pressures have shaped TYROBP's role in immunity and beyond?

    • How do species-specific differences in TYROBP signaling inform translational research?

These questions highlight the need for integrated approaches spanning molecular, cellular, and systems biology to fully understand TYROBP's complex roles .

What methodological innovations might advance TYROBP research in the next five years?

Anticipated methodological innovations for TYROBP research include:

  • Single-cell multiomics approaches:

    • Integrated single-cell RNA/protein profiling of TYROBP+ cells

    • Spatial transcriptomics with subcellular resolution

    • Single-cell epigenetic profiling of TYROBP regulatory elements

    • Live-cell molecular recording of TYROBP signaling dynamics

  • Advanced in vivo imaging technologies:

    • Intravital multiphoton microscopy with genetic TYROBP reporters

    • PET imaging with TYROBP-targeting radiotracers

    • Whole-body clearing techniques for system-wide TYROBP visualization

    • Super-resolution microscopy of TYROBP signaling complexes

  • Artificial intelligence applications:

    • Deep learning for prediction of TYROBP interaction networks

    • Machine learning classification of TYROBP-associated disease phenotypes

    • AI-assisted design of TYROBP-targeting therapeutics

    • Automated image analysis for TYROBP expression in clinical samples

  • Precision genetic engineering:

    • Base editing and prime editing for precise TYROBP modification

    • RNA editing approaches for reversible TYROBP manipulation

    • CRISPR screening of TYROBP regulatory elements

    • In vivo cell type-specific epigenetic editing of TYROBP locus

These innovations will help address the complex and sometimes contradictory findings regarding TYROBP function, potentially revealing new therapeutic targets for conditions ranging from neurodegenerative diseases to cancer .

How might translational TYROBP research bridge basic science findings with clinical applications?

Translational TYROBP research strategies to bridge basic science and clinical applications:

  • Biomarker development pipeline:

    • Validation of TYROBP expression as a prognostic biomarker across diseases

    • Development of standardized assays for TYROBP quantification in clinical samples

    • Correlation of TYROBP-associated signatures with treatment response

    • Integration of TYROBP status into clinical decision algorithms

  • Therapeutic target validation:

    • Systematic validation of TYROBP modulation effects in preclinical disease models

    • Development of humanized antibodies targeting TYROBP or its complexes

    • Small molecule screens for TYROBP signaling modulators

    • Cell type-specific delivery systems for TYROBP-targeting therapeutics

  • Clinical study design considerations:

    • Stratification of patients based on TYROBP expression profiles

    • Incorporation of TYROBP analysis in clinical trial biomarker panels

    • Assessment of TYROBP as a pharmacodynamic marker of treatment effect

    • Longitudinal monitoring of TYROBP-expressing cells during disease progression

  • Cross-disciplinary collaboration frameworks:

    • Integration of computational biology with clinical proteomics

    • Partnerships between neuroscience and immunology research communities

    • Biobank development with standardized TYROBP profiling

    • Open-source data sharing platforms for TYROBP-focused research

Translational research has already identified TYROBP as a key prognostic factor in gastric cancer and demonstrated its potential role in modulating tumor immune environments, providing a foundation for clinical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.