Recombinant Mouse Tyrosine-protein kinase STYK1 (Styk1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Tyrosine-Protein Kinase STYK1 (Styk1)

STYK1, also known as serine/threonine/tyrosine kinase 1 or NOK, is a member of the receptor tyrosine kinase (RTK) family and has been identified as an oncogenic protein . STYK1 contains a single transmembrane domain and an intracellular tyrosine kinase domain, but lacks most of the extracellular N-terminal domain, unlike other RTK members .

Role in Autophagy

STYK1 is a regulator of autophagy, which is a crucial process in development, cardiovascular and metabolic diseases, and oncogenesis . STYK1 enhances the assembly of the autophagy-specific class III phosphatidylinositol 3-kinase complex I (PtdIns3K-C1), which is essential for autophagosome formation . Studies have shown that STYK1 promotes autophagosome formation in human cells and zebrafish, which is characterized by increased levels of LC3-II, decreased levels of SQSTM1/p62, and increased puncta formation by marker proteins like ATG14, WIPI1, and ZFYVE1 .

2.1. Mechanism of Autophagy Regulation

STYK1 directly binds to the PtdIns3K-C1 complex as a homodimer, and this binding is promoted by Tyr191 phosphorylation, which elevates the kinase activity of STYK1 . STYK1 also increases the serine phosphorylation of BECN1, reducing the interaction between BECN1 and BCL2 . Additionally, STYK1 facilitates the assembly of the PtdIns3K-C1 complex and is required for its kinase activity .

Involvement in Cancer

STYK1 has been reported to promote cervical cancer, the development and metastasis of hepatocellular carcinoma, and the formation and remodeling of blood and lymphatic vessels during tumor progression . Mutation of Tyr327 or Tyr356 in the STYK1 kinase domain to phenylalanine (STYK1Y327F,Y356F) reduces tyrosine phosphorylation levels and significantly suppresses tumor progression .

3.1. Impact on Drug Resistance

STYK1 acts as a resistance factor against anticancer drugs . Overexpression of STYK1 leads to a significant decrease in drug sensitivity by inhibiting caspase activity .

3.2. Influence on Gene Expression

Microarray analyses have identified genes regulated by STYK1, including those related to cell proliferation, death, and stem cell renewal . STYK1 induces the expression of other receptor protein tyrosine kinases and molecules important for NF-κB activation, suggesting that multiple tyrosine kinases may cooperatively stimulate cell survival signals to promote drug resistance . STYK1 also induces the expression of stem cell replicators SALL4 and NOV, which are highly expressed in hematopoietic stem cells and associated with drug resistance in leukemic cells .

The following table lists genes related to cell proliferation or death whose expression was altered ≥4-fold by STYK1 expression :

GeneDescription
SALL4A transcription factor involved in stem cell maintenance and embryonic development
NOVA secreted protein that promotes cell growth and inhibits apoptosis
Tyrosine KinasesIncreased mRNA expression of three different tyrosine kinases was detected.
NF-κB-activating moleculesThe expression of NF-κB-activating molecules was inversely regulated, which may contribute to drug resistance.
Cell death-promoting moleculesThe expression of cell death-promoting molecules was inversely regulated, which may contribute to drug resistance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Styk1; Nok; Tyrosine-protein kinase STYK1; Novel oncogene with kinase domain; mNOK; Serine/threonine/tyrosine kinase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-429
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Styk1
Target Protein Sequence
MGEKGHLSRVLLECSLSDKLCVVREKQYEVIIVPALLVGGFLILLAIILWLFIRGQRSQR QSPGPRGTASVPASRGRSQEAAGHGEKVLLPLKETSVEGFLRAATPRLAKLQVPREQLLE VLEQIHSGSCGTLYHATMTTKDHPKPKSVVLKALEDPVGLQEVQDFIGRIQFYQYLGKHK NLVQLEGCCTERLPLYMMLEDVVPGDLLSFLWTCRRDVMTMDGLLYDLTEKQIYHIGKQI LLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHAHGAISSARSSTIPLKWL APERLLLRPASIRGDIWSFGILLYEMVTLGAPPYPEVPPTSILQYLQRKKIMKRPSSCSH AMYNIMKCCWRWSEDSRPLLGQLLQRLEAASRSADDKAVLQVPELVVPELYADVAGIRAE SISYSFSVL
Uniprot No.

Target Background

Function

STYK1 is a probable tyrosine protein kinase exhibiting potent transforming capabilities in various cell lines, including NIH 3T3 fibroblasts and athymic nude mice. Overexpression induces tumor cell invasion and metastasis. Its mechanism of action may involve activation of both the MAP kinase and phosphatidylinositol 3'-kinase (PI3K) pathways.

Gene References Into Functions
  1. Point mutations at either Y327 or Y356 significantly inhibited NOK-mediated cellular transformation, as assessed by colony formation and cellular DNA synthesis. PMID: 16322230
Database Links
Protein Families
Protein kinase superfamily, Tyr protein kinase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in colon and small intestine. Weakly or not expressed in spleen, skeletal muscle, liver, kidney, heart and brain. Expressed in transformed kidney cell lines (COS-1 and HEK293T).

Q&A

What is STYK1 and what is its basic function in cellular signaling?

STYK1 (serine/threonine/tyrosine kinase 1) is an oncogenic protein belonging to the receptor tyrosine kinase (RTK) family. It plays critical roles in promoting cancer development and metastasis primarily through activating MEK/ERK and PI3K/AKT signaling pathways . Unlike many RTKs, STYK1 has a distinctive structure and function profile. It has been shown to facilitate the genesis and remodeling of blood and lymphatic vessels during tumor progression and modulates autophagy through improving ATG14-associated class III PI3K activity under basal conditions or in response to nutrient starvation . The protein's name reflects its ability to phosphorylate substrates on serine, threonine, and tyrosine residues, making it a versatile kinase in cellular signaling networks.

What experimental models are most suitable for studying mouse STYK1 function?

For in vitro studies, several cell line models have demonstrated utility in STYK1 research. Based on published literature, appropriate cell line models include lung cancer cell lines (Calu-1, SW900) and prostate cancer cell lines (22Rv1, LNCaP) . When selecting a model system, researchers should consider the endogenous expression levels of STYK1 in different cell lines and choose those that either naturally express STYK1 or can be effectively transfected with STYK1 expression vectors.

For in vivo studies, nude mouse xenograft models have been effectively used to study STYK1's role in metastasis. Specifically, tail vein injection of luciferase-labeled cells (either expressing normal or elevated levels of STYK1) followed by in vivo imaging has proven valuable for tracking metastatic spread . This approach allows for both qualitative visualization and quantitative analysis of metastatic potential influenced by STYK1 expression levels.

What are the recommended methods for detecting STYK1 expression in mouse tissue samples?

Several complementary approaches are recommended for comprehensive analysis of STYK1 expression:

  • RNA analysis: RT-qPCR using specific primers for mouse STYK1 provides quantitative assessment of mRNA expression levels . This method is valuable for initial screening and relative quantification.

  • Protein detection: Western blotting using validated anti-STYK1 antibodies allows for semi-quantitative analysis of protein expression. When selecting antibodies, those raised against conserved epitopes between human and mouse STYK1 may be appropriate, but species-specific antibodies are preferable .

  • Tissue localization: Immunohistochemistry using paraffin-embedded sections provides information on spatial distribution of STYK1 within tissues. Research indicates STYK1 typically shows cytoplasmic localization in cancer cells . For validation of antibody specificity, paraffin-embedded blocks of cell lines with known STYK1 expression levels can serve as controls.

When interpreting results, researchers should be aware that discrepancies between mRNA and protein levels of STYK1 have been observed in some studies, potentially due to post-transcriptional regulatory mechanisms .

What are the most effective methods for modulating STYK1 expression in experimental systems?

Based on published research, several approaches have proven effective for modulating STYK1 expression:

For knockdown studies:

  • shRNA transfection: Multiple shRNA constructs targeting different regions of STYK1 mRNA should be tested to identify those with highest knockdown efficiency. Studies have shown that construct-specific efficiency can vary significantly, with some achieving over 80% reduction in expression . Verification of knockdown should be performed at both mRNA (RT-PCR) and protein (Western blot) levels.

  • siRNA transfection: For transient knockdown experiments, siRNA approaches have also demonstrated efficacy in reducing STYK1 expression, particularly in prostate cancer cell models .

For overexpression studies:

  • Full-length cDNA vectors: Cloning full-length mouse STYK1 cDNA into expression vectors (e.g., pIRES) with appropriate tags (myc-his) allows for overexpression and detection .

  • Kinase-dead mutants: Generation of kinase-dead mutants through site-directed mutagenesis (e.g., K147R substitution in the ATP-binding site) provides valuable experimental controls to distinguish between kinase-dependent and kinase-independent functions . This approach has been particularly informative in demonstrating that the cell growth-promoting effects of STYK1 depend on its kinase activity.

For optimal results, expression modulation should be verified using both RNA and protein detection methods before proceeding with functional assays.

How can I design a robust in vitro kinase assay for recombinant mouse STYK1?

A robust in vitro kinase assay for recombinant mouse STYK1 should include the following components and considerations:

Assay components:

  • Reaction buffer: A standard kinase buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 0.2 mM EDTA, 4 mM DTT, and 100 μM ATP provides appropriate conditions for STYK1 kinase activity .

  • Radioactive label: Including γ-32P-ATP (approximately 1.85 MBq) allows for detection and quantification of phosphorylation events .

  • Substrate selection: Several potential substrates should be tested, including histone H1, histone H3, and myelin basic protein (MBP), as these have been used in previous STYK1 studies . Additionally, whole cell lysates from relevant cell lines may contain natural substrates and can be included in parallel reactions.

Controls and validation:

  • Kinase-dead mutant: Including a kinase-dead mutant (K147R) of recombinant STYK1 as a negative control is essential for distinguishing true kinase activity from background phosphorylation .

  • Substrate-free reaction: Running a reaction without added substrate helps identify potential autophosphorylation of STYK1.

  • Time course: Performing the reaction at multiple time points (5, 15, 30, 60 minutes) provides information on kinetics of the reaction.

Detection methods:
After 30 minutes incubation at 30°C, the reaction should be stopped by adding SDS sample buffer, followed by boiling and separation on 5-20% gradient gels. Autoradiography or phosphorimaging can then be used to detect phosphorylated substrates . For non-radioactive alternatives, phospho-specific antibodies can be used if available for the specific substrates being tested.

What functional assays are most informative for studying STYK1's role in cancer progression?

Based on the research literature, the following functional assays have proven most informative for elucidating STYK1's roles in cancer:

Cell proliferation and viability assays:

  • MTT assay: This colorimetric assay has effectively demonstrated that both knockdown and overexpression of STYK1 significantly impact cancer cell growth .

  • Colony formation assay: This longer-term assay provides information on the clonogenic potential of cells with modulated STYK1 expression and has shown dramatic effects when STYK1 is knocked down .

Migration and invasion assays:

  • Real-Time Cell Analysis (RTCA): This technology offers advantages over traditional Transwell assays by providing real-time, quantitative monitoring of migrated or invaded cells, minimizing measurement error . The system detects impedance changes caused by cells attached to electrode sheets and calculates a cell index that reflects the number of migrated/invaded cells.

  • Crystal violet staining: This qualitative method complements RTCA by providing visual confirmation of migration/invasion effects .

Epithelial-Mesenchymal Transition (EMT) assessment:

  • Immunoblotting for EMT markers: Analysis of classic EMT biomarkers (E-cadherin, vimentin, N-cadherin) by Western blotting following STYK1 modulation provides insights into mechanisms of STYK1-induced metastasis .

In vivo metastasis models:

  • Tail vein injection: Injecting luciferase-labeled cancer cells with modified STYK1 expression into nude mice allows for:

    • Bioluminescent imaging to track metastasis formation in real time

    • Quantification of photon emission as a measure of metastatic burden

    • Histological confirmation of metastatic foci in target organs

These complementary approaches provide a comprehensive assessment of STYK1's functional roles in multiple aspects of cancer progression.

How does phosphorylation affect STYK1 function and what are the key regulatory sites?

STYK1 function is significantly regulated through phosphorylation events that affect its kinase activity and interactions with other proteins. Current research has identified several key phosphorylation sites and regulatory mechanisms:

The Y356 site has been identified as a critical phosphorylation site on STYK1. Epidermal growth factor receptor (EGFR) has been shown to phosphorylate STYK1 at this tyrosine residue in an EGFR kinase activity-dependent manner . This phosphorylation appears to be functionally significant, as phosphorylated STYK1 inhibits activated EGFR-mediated Beclin1 tyrosine phosphorylation and disrupts the interaction between Bcl2 and Beclin1 . These events enhance PtdIns3K-C1 complex assembly and autophagy initiation.

The relationship between STYK1 phosphorylation status and its kinase activity remains an active area of investigation. Research suggests that phosphorylation may serve as a molecular switch that determines whether STYK1 promotes cell survival through autophagy or enhances cell proliferation through other signaling pathways. The dual role of STYK1 in both autophagy regulation and cancer progression highlights the complexity of its signaling networks and the importance of post-translational modifications in determining its functional outputs.

What are the key signaling pathways downstream of STYK1 activation in tumorigenesis?

STYK1 influences tumor development and progression through multiple interconnected signaling pathways:

  • MEK/ERK and PI3K/AKT pathways: STYK1 has been demonstrated to promote cancer development and metastasis through activating these canonical signaling cascades . These pathways are central to cellular proliferation, survival, and metabolism, explaining the growth-promoting effects observed with STYK1 overexpression.

  • Autophagy regulation: STYK1 plays an important role in modulating autophagy through improving ATG14-associated class III PI3K activity . This function becomes particularly significant in the context of cancer therapy, as autophagy has emerged as a potential mechanism involved in acquired resistance to anti-EGFR treatments.

  • EGFR-related signaling: Research has identified a complex interplay between STYK1 and EGFR, where EGFR phosphorylates STYK1, and phosphorylated STYK1 in turn restrains certain EGFR functions related to autophagy inhibition . This reciprocal regulation suggests STYK1 may modulate responses to EGFR-targeted therapies.

  • FoxO1 regulation: STYK1 has been shown to suppress FoxO1 activity, which subsequently promotes metastasis and epithelial-mesenchymal transition in non-small cell lung cancer . This mechanism provides a direct link between STYK1 expression and the invasive properties of cancer cells.

The integration of these multiple pathways downstream of STYK1 activation contributes to its potent oncogenic effects across different cancer types, making it a potential therapeutic target of considerable interest.

How does STYK1 contribute to therapy resistance mechanisms in cancer?

STYK1 has been implicated in several mechanisms of therapy resistance in cancer, particularly in the context of targeted therapies:

  • Autophagy-mediated resistance: Research has identified that STYK1 plays a role in modulating autophagy, which has emerged as a potential mechanism involved in acquired resistance to anti-EGFR treatments . Specifically, STYK1 inhibits activated EGFR-mediated Beclin1 tyrosine phosphorylation and interaction between Bcl2 and Beclin1, enhancing PtdIns3K-C1 complex assembly and autophagy initiation. This STYK1-driven autophagy may provide a survival advantage to cancer cells under therapeutic stress.

  • EGFR-TKI resistance: Studies have demonstrated that STYK1 depletion increased the sensitivity of non-small cell lung cancer (NSCLC) cells to EGFR tyrosine kinase inhibitors (EGFR-TKIs) . This suggests that elevated STYK1 expression may contribute to resistance against these targeted therapies, possibly through activation of alternative signaling pathways that bypass EGFR inhibition.

  • Promotion of epithelial-mesenchymal transition (EMT): STYK1 has been shown to promote EMT in cancer cells , a process strongly associated with therapy resistance across multiple cancer types and treatment modalities. EMT-related changes in cell phenotype, including altered drug uptake, increased drug efflux, and activation of anti-apoptotic pathways, may all contribute to STYK1-mediated therapy resistance.

  • Androgen-independent signaling: In the context of prostate cancer, STYK1 overexpression in castration-resistant prostate cancer (CRPC) suggests it may contribute to androgen-independent growth mechanisms , potentially undermining the efficacy of androgen deprivation therapies.

These multiple resistance mechanisms highlight the potential value of targeting STYK1 as part of combination therapy approaches to overcome treatment resistance in cancer.

What are the implications of STYK1 expression as a prognostic biomarker in different cancer types?

Research has revealed significant associations between STYK1 expression and clinical outcomes across multiple cancer types:

In prostate cancer, immunohistochemical analysis has demonstrated strong positive staining for STYK1 in castration-resistant prostate cancer (CRPC) samples, with 65% of conventional prostate cancers also showing strong STYK1 expression . The staining is typically observed in the cytoplasm of prostate cancer cells, while normal prostate epithelial cells show very weak or no expression. Interestingly, in conventional prostate cancer, STYK1 expression patterns did not correlate with Gleason scores , suggesting it may provide prognostic information independent of traditional histopathological grading.

For optimal use as a prognostic biomarker, quantitative assessment methods should be standardized, potentially using H-score or other semi-quantitative scoring systems for immunohistochemistry. Additionally, combining STYK1 expression with other molecular markers may improve prognostic accuracy and help stratify patients for appropriate therapeutic interventions.

How can recombinant mouse STYK1 be used to develop and screen potential STYK1 inhibitors?

Recombinant mouse STYK1 provides a valuable tool for developing and screening potential inhibitors through a systematic approach:

Structural analysis and inhibitor design:

  • Recombinant mouse STYK1 can be used for structural studies, including X-ray crystallography or cryo-EM, to identify key structural features of the kinase domain and substrate-binding regions. This information is essential for structure-based drug design of selective inhibitors.

  • The ATP-binding site, which contains the conserved lysine residue at position 147 (K147) demonstrated to be essential for kinase activity , represents a primary target for competitive inhibitor development.

High-throughput screening platforms:

  • In vitro kinase assays: Using purified recombinant mouse STYK1 in a standardized in vitro kinase assay format allows for high-throughput screening of compound libraries. The assay should incorporate appropriate substrates (such as histone H1, histone H3, or myelin basic protein) and detection methods (radiometric, fluorescence-based, or antibody-based) to measure inhibition of kinase activity.

  • Thermal shift assays: These can assess compound binding to recombinant STYK1 by measuring shifts in protein melting temperature upon inhibitor binding.

Validation of hits:

  • Secondary cellular assays: Compounds showing activity in primary screens should be validated in cellular models where STYK1 is known to promote growth, such as 22Rv1 or LNCaP prostate cancer cells . Comparing effects in cells with normal vs. knocked-down STYK1 expression helps confirm target specificity.

  • Kinase selectivity profiling: Testing promising inhibitors against panels of related and unrelated kinases is essential to assess selectivity and potential off-target effects.

  • Structure-activity relationship studies: Using recombinant STYK1 to test series of structural analogs helps optimize potency and selectivity of lead compounds.

The development of selective STYK1 inhibitors could provide both valuable research tools and potential therapeutic agents for cancers where STYK1 plays a significant oncogenic role.

What experimental approaches best demonstrate STYK1's role in metastasis and invasion for therapeutic targeting?

To comprehensively demonstrate STYK1's role in metastasis and invasion for therapeutic targeting, a multi-level experimental approach is recommended:

In vitro metastasis-related assays:

  • Real-Time Cell Analysis (RTCA): This technology provides real-time, quantitative monitoring of cell migration and invasion, offering advantages over traditional Transwell assays by minimizing measurement error . The combination of RTCA with qualitative crystal violet staining provides robust evidence of STYK1's effects on cellular motility.

  • EMT marker analysis: Comprehensive assessment of epithelial markers (E-cadherin), mesenchymal markers (vimentin, N-cadherin), and EMT-inducing transcription factors (Snail, Slug, ZEB1) following modulation of STYK1 expression reveals underlying mechanisms . Western blotting, immunofluorescence, and qRT-PCR should be used in combination for thorough characterization.

In vivo metastasis models:

  • Luciferase-labeled cell injection models: Tail vein injection of luciferase-expressing cells with modified STYK1 levels allows for non-invasive tracking of metastatic spread over time . Both qualitative imaging and quantitative analysis of photon emission provide measurable endpoints for assessing intervention efficacy.

  • Orthotopic implantation models: These more closely recapitulate the natural process of metastasis from primary tumors and provide additional information about effects on primary tumor growth and local invasion.

  • Intervention studies: Testing potential STYK1-targeting approaches (inhibitors, antibodies, etc.) in established metastasis models provides proof-of-concept for therapeutic applications.

Mechanistic validation:

  • Pathway analysis: Determining whether STYK1 inhibition affects downstream targets (e.g., FoxO1 activity) or related signaling pathways (MEK/ERK, PI3K/AKT) confirms the molecular mechanisms being targeted.

  • Combination approaches: Testing STYK1-targeting agents in combination with current standard-of-care therapies (e.g., EGFR-TKIs in lung cancer) can reveal synergistic potentials that may translate to clinical applications.

This comprehensive approach provides multiple lines of evidence connecting STYK1 to metastatic processes and offers varied experimental platforms for evaluating potential therapeutic interventions.

How do I reconcile discrepancies between STYK1 mRNA and protein expression data?

Researchers have observed interesting discrepancies between STYK1 mRNA and protein levels, particularly in cancer cell lines. Several methodological and biological factors may contribute to these discrepancies, and a systematic approach can help reconcile such differences:

Methodological considerations:

  • Primer specificity verification: When mRNA and protein data appear discordant, verify the specificity of PCR primers by sequencing amplification products to confirm target identity. Studies have reported performing this validation to exclude the possibility of non-specific amplification .

  • Antibody validation: Similarly, antibody specificity should be rigorously validated. Creating paraffin-embedded blocks of cell lines with known STYK1 expression levels for immunohistochemistry can serve as appropriate controls to confirm that staining signals align with expected expression patterns .

  • Quantification methods: Consider whether differences in the sensitivity and dynamic range of RNA vs. protein detection methods may contribute to apparent discrepancies. RT-qPCR typically has a broader dynamic range than Western blotting.

Biological mechanisms:

  • Post-transcriptional regulation: Evidence suggests microRNAs may play a significant role in regulating STYK1 expression. Studies have identified miR-203 and miR-27 as potential regulators of STYK1, and these microRNAs have been found to be downregulated in NSCLC . This finding could explain scenarios where protein levels appear higher than would be predicted from mRNA levels.

  • Protein stability differences: Research suggests that SUMO1 protein, which is upregulated in NSCLC, correlates positively with STYK1 protein levels, potentially by suppressing STYK1 degradation . Variations in protein stability and turnover rates between different cell types or tissue contexts may therefore contribute to mRNA-protein discrepancies.

  • Tumor microenvironment effects: In vivo factors absent in cell culture systems may influence either transcription or translation efficiency of STYK1, potentially explaining differences between tissue samples and cell lines .

When encountering such discrepancies, it is advisable to use complementary approaches (e.g., immunohistochemistry alongside Western blotting) and to consider the biological context (cell lines vs. primary tissues) when interpreting results.

What statistical approaches are most appropriate for analyzing STYK1 expression in relation to patient outcomes?

When analyzing STYK1 expression in relation to patient outcomes, several statistical approaches have demonstrated utility in the research literature:

For survival analysis:

For correlation with clinicopathological features:

  • Chi-square tests or Fisher's exact test: These have been used to analyze associations between STYK1 expression levels (categorized as high/low) and categorical clinical variables such as stage, histological type, or the presence of metastasis .

  • Student's t-test or ANOVA: For comparing STYK1 expression levels (as a continuous variable) between different clinical subgroups, these parametric tests are appropriate when data follow normal distribution . Non-parametric alternatives (Mann-Whitney or Kruskal-Wallis) should be used when normality assumptions are violated.

For meta-analysis of multiple datasets:

  • Random-effects models: When combining data from multiple independent studies or datasets (as in the analysis of ONCOMINE data), random-effects models account for between-study heterogeneity and provide more conservative estimates of effect sizes .

  • Forest plots and funnel plots: These visual representations help assess consistency of findings across datasets and evaluate potential publication bias.

Addressing potential biases:
Researchers should be aware of potential selection biases, particularly when working with retrospective cohorts. In one study, researchers noted that including only surgical cases might not represent all stages of NSCLC, potentially affecting the ability to establish STYK1 as an independent prognostic factor . Transparent reporting of selection criteria and acknowledgment of such limitations is essential for proper interpretation of statistical findings.

How should discordant findings on STYK1 function between different cancer models be interpreted?

When faced with discordant findings on STYK1 function across different cancer models, a systematic interpretative framework should be applied:

Context-dependent biological mechanisms:

  • Tissue-specific signaling networks: STYK1 may interact with different signaling partners depending on the cellular context. For example, its interaction with EGFR in certain cancer types may not be replicated in others where EGFR expression or activation differs . Researchers should map the tissue-specific interactome of STYK1 to better understand these contextual differences.

  • Genetic background effects: The broader mutational landscape of different cancer models may influence STYK1 function. Cell lines or animal models with different driver mutations may show variable dependency on STYK1-mediated pathways. Comprehensive genetic characterization of experimental models is therefore essential for proper interpretation.

Methodological considerations:

  • Expression level variations: Differences in the degree of STYK1 overexpression or knockdown efficiency between studies may lead to apparently discordant phenotypic effects. Standardizing expression modulation approaches and clearly reporting achieved expression levels would facilitate cross-study comparisons.

  • Endpoint selection: Different studies may evaluate different functional endpoints (proliferation, migration, invasion, etc.), potentially missing context-specific effects of STYK1. Comprehensive phenotypic characterization using multiple complementary assays provides a more complete picture of STYK1 function.

  • Temporal dynamics: Short-term versus long-term experiments may reveal different aspects of STYK1 function. Some effects may be immediate (kinase activity) while others may require prolonged expression changes (effects on differentiation or adaptation).

Integration strategies:

  • Pathway-focused reconciliation: Rather than focusing on discordant phenotypic endpoints, analyzing the consistency of STYK1's effects on specific molecular pathways (MEK/ERK, PI3K/AKT, FoxO1, etc.) across models may reveal underlying mechanistic conservation despite phenotypic variations .

  • Meta-analysis approaches: Formal meta-analysis of quantitative data from multiple studies and models can help identify factors that explain heterogeneity in STYK1 function. This approach requires standardized reporting of effect sizes and methodological details.

  • Direct comparative studies: When possible, direct side-by-side comparison of STYK1 function in multiple cancer models under identical experimental conditions provides the most robust approach to confirm and characterize context-dependent effects.

By systematically considering these factors, researchers can transform apparently discordant findings into deeper insights about the context-dependent functions of STYK1 in cancer biology.

What are common challenges in producing active recombinant mouse STYK1 and how can they be overcome?

Producing active recombinant mouse STYK1 presents several technical challenges that researchers should anticipate and address:

Expression system selection:
Different expression systems offer distinct advantages and limitations for STYK1 production:

  • Bacterial systems (E. coli): While cost-effective and high-yielding, bacterial expression often results in insoluble or improperly folded kinases due to lack of post-translational modifications. If using E. coli, fusion tags (such as MBP or SUMO) can improve solubility. Additionally, expression at lower temperatures (16-20°C) following induction may improve folding.

  • Insect cell systems: Baculovirus-infected insect cells (Sf9, Sf21, Hi5) provide eukaryotic folding machinery and some post-translational modifications. This system has been successfully used for many kinases and represents a good compromise between yield and proper folding for STYK1.

  • Mammalian expression: For applications requiring fully authentic post-translational modifications, transient or stable expression in mammalian cells (HEK293, CHO) may be necessary, though yields are typically lower.

Purification considerations:

Activity verification:

  • Autophosphorylation: Many kinases, including STYK1, can undergo autophosphorylation. Incubating purified STYK1 with ATP and detecting phosphorylation by Western blotting with phospho-specific antibodies or mass spectrometry can confirm basic catalytic competence.

  • Substrate phosphorylation: Testing activity on known substrates such as histone H1, histone H3, or myelin basic protein using radioactive (γ-32P-ATP) or non-radioactive detection methods confirms functional activity .

  • Thermal stability assay: Differential scanning fluorimetry comparing stability in the presence and absence of ATP can provide evidence of proper folding and nucleotide binding.

By systematically addressing these challenges, researchers can optimize production of active recombinant mouse STYK1 suitable for structural studies, inhibitor screening, and mechanistic investigations.

What controls are essential when performing functional studies on STYK1 in cancer models?

When conducting functional studies on STYK1 in cancer models, several essential controls should be incorporated to ensure robust and interpretable results:

For gene expression modulation studies:

  • Multiple shRNA/siRNA constructs: When knocking down STYK1, at least 3-4 different shRNA constructs targeting different regions of the mRNA should be tested. Studies have demonstrated that some constructs (e.g., si1 and si3) effectively reduced STYK1 expression while others (e.g., si2) did not . Including both effective and ineffective constructs provides internal validation that observed phenotypes correlate with knockdown efficiency.

  • Scrambled sequence controls: Non-targeting shRNA/siRNA with similar length and GC content serves as the appropriate negative control for knockdown studies .

  • Rescue experiments: Re-expressing shRNA-resistant STYK1 in knockdown cells confirms phenotype specificity and excludes off-target effects.

  • Kinase-dead mutants: For overexpression studies, parallel expression of kinase-dead mutants (e.g., K147R mutation in the ATP-binding site) differentiates between kinase-dependent and kinase-independent functions . Research has shown that while wild-type STYK1 overexpression promoted cell proliferation, kinase-dead STYK1 did not, confirming the importance of kinase activity for this phenotype.

For phenotypic assays:

For in vivo studies:

  • Sample size calculation: Proper statistical power analysis should determine animal numbers needed for meaningful results. Studies have used three mice per group for initial assessment of metastatic potential .

  • Multiple detection methods: Combining in vivo imaging (for longitudinal monitoring) with endpoint histopathological analysis (for detailed characterization) provides complementary data on metastasis formation .

  • Vector controls: When using viral vectors for gene delivery, appropriate empty vector controls must be included to account for potential vector-related effects.

Implementing these comprehensive controls ensures that functional studies on STYK1 yield reliable and interpretable results that can advance understanding of its role in cancer biology.

How can I address the issue of low transfection efficiency when studying STYK1 in difficult-to-transfect cancer cell lines?

Working with difficult-to-transfect cancer cell lines presents challenges for STYK1 functional studies. Several strategies can improve efficiency and experimental outcomes:

Optimization of chemical transfection:

Viral vector approaches:

  • Lentiviral systems: For particularly resistant cell lines, lentiviral delivery of STYK1 expression constructs or shRNAs typically achieves higher efficiency than chemical transfection. This approach has been successfully used in STYK1 studies, particularly for stable expression modulation .

  • Adenoviral vectors: These can provide high transduction efficiency and transient expression without genomic integration, useful for short-term functional studies.

Enrichment strategies:

  • Fluorescent reporters: Including fluorescent markers (GFP, mCherry) in the same vector as STYK1 or on a co-transfected plasmid allows for:

    • Visual assessment of transfection efficiency

    • Fluorescence-activated cell sorting (FACS) to enrich for transfected cells

    • Gating on transfected cells during flow cytometry-based assays

  • Selection markers: For stable expression, including antibiotic resistance genes (puromycin, geneticin) permits selection of successfully transfected cells. Studies have employed geneticin selection for 24 days to establish stable STYK1 knockdown cell populations .

Alternative delivery methods:

  • Electroporation: For cell lines resistant to chemical transfection, electroporation often yields higher efficiency. Nucleofector technology (Lonza) offers cell-type specific protocols optimized for difficult lines.

  • Nanoparticle-based delivery: Magnetic nanoparticles conjugated to DNA can improve delivery to resistant cells when combined with magnetic fields.

Experimental design adaptations:

  • Single-cell analysis: When population transfection efficiency remains low despite optimization, techniques that allow analysis at the single-cell level (immunofluorescence, flow cytometry) can still yield valuable data by comparing transfected and untransfected cells within the same population.

  • Inducible expression systems: For long-term studies, establishing stable lines with doxycycline-inducible STYK1 expression provides more uniform expression and temporal control.

By systematically addressing transfection challenges through these approaches, researchers can overcome technical limitations in studying STYK1 function even in difficult cell line models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.