Recombinant Mouse Ubiquitin-associated domain-containing protein 2 (Ubac2)

Shipped with Ice Packs
In Stock

Description

Introduction and Basic Characteristics

Ubac2 (gene: Ubac2) is a ubiquitin-associated domain-containing protein implicated in endoplasmic reticulum (ER) quality control and selective autophagy. The recombinant form is produced in cell-free systems, E. coli, yeast, or mammalian cells, with purity ≥85% confirmed by SDS-PAGE .

Key Features

ParameterDetails
Gene NamesUbac2, Phgdhl1, AW554959, 1190008A14Rik
Host SystemsCell-free expression, E. coli, yeast, mammalian cells
Purity≥85% (SDS-PAGE validated)
ApplicationsELISA, Western blot, immunohistochemistry, autophagy/ER stress studies

Domain Architecture

Ubac2 contains a UBA (Ubiquitin-Associated) domain, critical for binding ubiquitin-like modifiers, and a LIR (LC3-Interacting Region) motif, enabling interactions with autophagosomal proteins like GABARAP .

Isoforms and Interactions

  • Isoforms: Transcript variants include Ubac2 isoform 1 and 2, with differential tissue expression .

  • Interactome:

    • GABARAP: Facilitates ER-phagy by directing ER membranes to autophagosomes .

    • MARK2: Phosphorylates Ubac2 at Serine 223, promoting dimerization and enhancing ER-phagy flux .

    • ATI3/PICC: In Arabidopsis, Ubac2 interacts with ER-associated proteins to regulate pathogen-triggered immunity (PTI) and callose deposition .

Functional Roles in Autophagy and ER Stress

Study FocusKey FindingsSource
ER-phagy RegulationUbac2 acts as a receptor for ER-phagy, reducing ER stress and inflammation
Pathogen ResponseUbac2 mutants in Arabidopsis show impaired callose deposition and PTI
Bladder Cancer ProliferationUbac2 knockdown inhibits proliferation via BCRC-3/miR-182-5p/p27 axis

Genetic and Disease Associations

DiseaseMechanismEvidence
Behçet’s DiseasePromoter SNP rs3825427 reduces Ubac2 expression, increasing disease risk GWAS and functional studies
Bladder CancerOverexpression promotes proliferation via BCRC-3/p27 regulation TCGA data and in vivo models
Inflammatory ColitisUbac2 KO mice exhibit exacerbated DSS-induced colitis via ER stress Preclinical murine models

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Ubac2; Phgdhl1; Ubiquitin-associated domain-containing protein 2; UBA domain-containing protein 2; Phosphoglycerate dehydrogenase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
40-345
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Ubac2
Target Protein Sequence
FFVYDLHAVKHDLQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRYGSRKFASFLLGS WVLSALFDFILVEAVQYSLGVTVASNLPSGFLAPVFALFVPFHCSIPRVQVAQILGPLSI TNKTLIYILGLQLFTSGSYIWIVAMSGLISGMCYDRKVLQVHQVLRIPGRMAEFFSWALE PIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLMLSQFAQVRRQRQQQGGMINWNRLF PPLRQRRNINYQDGPRSEQRASPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVAT NFLLQH
Uniprot No.

Target Background

Function

UBAC2 restricts the trafficking of FAF2 from the endoplasmic reticulum to lipid droplets. In conjunction with LMBR1L and the E3 ubiquitin-protein ligase AMFR, UBAC2 negatively regulates the canonical Wnt signaling pathway in lymphocytes by promoting the ubiquitin-mediated degradation of β-catenin (CTNNB1) and Wnt receptors FZD6 and LRP6.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Ubiquitin-associated domain-containing protein 2 (Ubac2) and what are its key characteristics?

Ubiquitin-associated domain-containing protein 2 (Ubac2) is a mouse protein also known as Phosphoglycerate dehydrogenase-like protein 1, with UniProt accession number Q8R1K1 . The protein is encoded by the Ubac2 gene (synonym: Phgdhl1) and contains a functional expression region spanning amino acids 40-345 . Ubac2 belongs to the broader family of ubiquitination-associated (UA) proteins, which play crucial roles in the post-translational modification system that influences numerous fundamental cellular processes in eukaryotic organisms . The protein contains a characteristic ubiquitin-associated (UBA) domain that enables it to interact with ubiquitin and ubiquitinated substrates within the cellular environment. The complete amino acid sequence of mouse Ubac2 includes specific motifs that facilitate its biological functions within the complex ubiquitination machinery that regulates protein degradation, cellular signaling, and other essential processes .

How does Ubac2 fit into the broader ubiquitination pathway ecosystem?

Ubac2 functions within the complex ubiquitination system that consists of four primary classes of enzymes: ubiquitin-activating enzymes (E1), ubiquitin-conjugating enzymes (E2), ubiquitin protein ligases (E3), and de-ubiquitinating enzymes (DUBs) . While Ubac2 itself is not one of these enzymes, it contains a ubiquitin-associated domain that enables it to interact with this system, potentially serving as a scaffold or regulator within ubiquitination pathways. The ubiquitination ecosystem has evolved differently across species, with more complex organisms generally exhibiting more elaborate systems with higher numbers of E1, E2, and E3 proteins compared to simpler organisms . Comparative proteomics studies of ubiquitination across different species have revealed that mice and humans possess higher numbers of E1 and E2 proteins than organisms like Drosophila, C. elegans, and yeast, suggesting that the complexity of the ubiquitination system correlates with developmental complexity . Understanding Ubac2's specific role requires consideration of its interactions with various components of this ecosystem and the cellular contexts in which these interactions occur.

What methodologies are recommended for initial characterization of Ubac2 in mouse models?

For initial characterization of Ubac2 in mouse models, researchers should implement a multi-faceted approach beginning with expression analysis using quantitative PCR and western blotting to establish tissue-specific expression patterns and protein levels . Immunohistochemistry should be employed to visualize the spatial distribution of Ubac2 within tissues and subcellular compartments, providing insights into potential functional roles. Generation of knockout or knockdown mouse models using CRISPR-Cas9 or RNAi technologies respectively can reveal phenotypic consequences of Ubac2 deficiency, while conditional knockout approaches may be necessary if complete deletion proves lethal. Protein interaction studies using co-immunoprecipitation followed by mass spectrometry analysis can identify binding partners within the ubiquitination pathway, particularly focusing on interactions with E3 ligases or ubiquitinated substrates . Functional assays should assess changes in ubiquitination patterns in the presence or absence of Ubac2, potentially revealing its role as a regulator or mediator within specific ubiquitination cascades. These methodological approaches should be complemented with careful experimental design that includes appropriate controls to account for potential contradictions in the literature regarding ubiquitin-associated proteins .

How should researchers design experiments to investigate contradictory findings about Ubac2 function?

When investigating contradictory findings regarding Ubac2 function, researchers should implement a systematic approach that begins with a comprehensive literature review to identify specific inconsistencies and their potential sources . Experimental design should incorporate multiple complementary techniques to examine each functional aspect, as reliance on a single methodology may contribute to contradictory outcomes. Researchers should carefully consider biological context variations, such as cell type, developmental stage, and physiological conditions, as Ubac2 may function differently across these contexts . For instance, contradictory findings about Ubac2's role in protein degradation pathways might stem from studies conducted in different cell types or under varying stress conditions. Experimental protocols should include appropriate positive and negative controls, and researchers should validate reagents such as antibodies and recombinant proteins to ensure specificity and functionality . Statistical approaches should be rigorous, with predetermined sample sizes based on power calculations and appropriate statistical tests for data analysis. When publishing results, researchers should explicitly acknowledge limitations and potential confounding factors, while also discussing how their findings relate to seemingly contradictory literature . This transparent approach helps address the "Proteus phenomenon" observed in molecular genetics research, where initial studies often show stronger effects than subsequent analyses .

What advanced techniques can be used to study Ubac2 protein-protein interactions within the ubiquitination pathway?

Advanced techniques for studying Ubac2 protein-protein interactions within the ubiquitination pathway should begin with proximity-based approaches such as BioID or APEX2 proximity labeling, which enable identification of transient or weak interactions that might be missed by traditional co-immunoprecipitation methods . Researchers can implement genetic code expansion (GCE) techniques to incorporate unnatural amino acids at specific positions within Ubac2, allowing for precise chemical crosslinking to capture interaction partners at the exact sites of contact . For studying dynamics of Ubac2 interactions, live-cell imaging using fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) provides temporal resolution of protein associations in physiologically relevant contexts. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers detailed insights into structural changes that occur during protein interactions, revealing binding interfaces and conformational shifts. To validate and quantify specific interactions, surface plasmon resonance (SPR) or microscale thermophoresis (MST) should be employed, providing binding kinetics and affinities. Integration of computational approaches, such as molecular dynamics simulations based on known protein structures, can predict potential interaction interfaces that guide experimental design . When investigating Ubac2's interactions with ubiquitin or ubiquitinated proteins, researchers should consider using synthetic Ub-protein conjugates generated through click chemistry or genetic code expansion approaches to mimic naturally occurring ubiquitinated substrates .

How can researchers effectively integrate Ubac2 data into knowledge graphs for computational drug repurposing?

To effectively integrate Ubac2 data into knowledge graphs for computational drug repurposing, researchers should first establish a standardized ontology for representing Ubac2-related entities and relationships, ensuring compatibility with existing biomedical knowledge frameworks . When extracting Ubac2 interaction data from scientific literature, natural language processing (NLP) techniques should be applied with specific attention to contextual qualifiers such as tissue specificity, experimental conditions, and confidence metrics to mitigate the risk of contradictory information in the resulting knowledge graph . Researchers should implement knowledge graph refinement preprocessing steps to identify and address inconsistencies, such as contradictory predications about Ubac2 interactions that might appear simultaneously in the literature (e.g., both "upregulates" and "downregulates" relationships between the same entities) . For representing uncertainty in Ubac2-related knowledge, probabilistic knowledge graph approaches that explicitly encode confidence scores for each relationship are recommended, allowing downstream analysis algorithms to appropriately weight evidence based on reliability . When integrating Ubac2 data with broader ubiquitination pathway information, researchers should preserve the hierarchical relationship between ubiquitination components (E1, E2, E3, DUBs) and their specific interactions with Ubac2 . To evaluate the quality of the resulting knowledge graph, validation against gold-standard datasets and application of graph-based metrics to identify potential inconsistencies or implausible relationship patterns is essential . Finally, when applying the integrated knowledge graph to drug repurposing, researchers should employ methods that can reason under uncertainty, such as soft logic or Bayesian approaches, acknowledging the incomplete and sometimes contradictory nature of Ubac2-related knowledge in current scientific literature .

How can genetic code expansion (GCE) approaches be utilized to study Ubac2's role in the ubiquitin code?

Genetic code expansion (GCE) approaches offer powerful tools for studying Ubac2's role in the ubiquitin code by enabling the incorporation of unnatural amino acids with unique chemical functionalities at specific positions within the protein structure . Researchers can utilize amber codon suppression technology to incorporate photo-crosslinking amino acids such as p-benzoyl-L-phenylalanine (pBpa) or diazirine derivatives at predicted interaction interfaces of Ubac2, allowing for UV-induced covalent capture of transient binding partners in living cells . For studying the structural dynamics of Ubac2, incorporation of spectroscopic probes like fluorescent amino acids can provide site-specific information about conformational changes upon binding to ubiquitin or other interaction partners. To investigate post-translational modifications of Ubac2 itself, GCE can be employed to directly incorporate pre-modified amino acids that mimic phosphorylation, acetylation, or other modifications at specific residues, enabling structure-function studies of how these modifications affect Ubac2's role in ubiquitination pathways . When studying Ubac2's interaction with ubiquitinated substrates, researchers can use GCE in combination with click chemistry to generate synthetic ubiquitin-protein conjugates with defined linkage types that serve as probe substrates . These approaches can be particularly valuable for distinguishing between Ubac2's interactions with different ubiquitin chain topologies, which may have distinct signaling outcomes. For challenging applications requiring multiple unnatural amino acids, researchers can consider orthogonal translation systems that enable incorporation of different unnatural amino acids at distinct positions within the same Ubac2 molecule, providing unprecedented control over protein engineering for functional studies .

What methodological approaches should be used to investigate tissue-specific functions of Ubac2 in mouse models?

To investigate tissue-specific functions of Ubac2 in mouse models, researchers should implement conditional genetic approaches using Cre-loxP technology to achieve tissue-selective deletion of Ubac2, allowing examination of its function in specific cell types while avoiding potential embryonic lethality of global knockouts . Complementary to genetic approaches, adeno-associated virus (AAV) vectors with tissue-specific promoters can deliver Ubac2 variants to particular tissues in adult mice, enabling rescue experiments or expression of mutant forms in specific cellular contexts. For temporal control over Ubac2 expression, inducible systems such as tetracycline-controlled transcriptional activation should be employed, allowing researchers to distinguish between developmental and maintenance roles of Ubac2 across different tissues . Advanced tissue clearing techniques combined with 3D imaging approaches can provide spatial information about Ubac2 expression and its colocalization with potential interaction partners across intact organs, revealing tissue microenvironments where Ubac2 functions are most prominent. To assess functional consequences of Ubac2 manipulation, tissue-specific phenotyping should be comprehensive, including histological analysis, functional assays relevant to each tissue type, and molecular profiling through techniques like spatial transcriptomics or proteomics . When analyzing ubiquitination patterns in specific tissues, researchers should consider using tandem ubiquitin binding entities (TUBEs) to enrich for ubiquitinated proteins before mass spectrometry analysis, improving detection sensitivity for low-abundance modifications that may be regulated by Ubac2 . For translational relevance, researchers should correlate tissue-specific findings from mouse models with available human data, acknowledging potential species differences in Ubac2 function while identifying conserved mechanisms that might have clinical significance .

What are the recommended protocols for generating and validating Ubac2 knockout and knockin mouse models?

For generating and validating Ubac2 knockout and knockin mouse models, researchers should begin with thorough in silico analysis of the Ubac2 gene structure to identify optimal targeting strategies that minimize off-target effects and ensure complete functional disruption . CRISPR-Cas9-based approaches represent the current gold standard for generating these models, with careful design of guide RNAs targeting early exons to ensure functional protein loss, while knockin strategies should include silent mutations that prevent re-cutting after homology-directed repair. Researchers should validate edited founders through comprehensive genotyping that includes both PCR-based strategies and sequencing of the entire targeted region to confirm precise modifications and exclude unintended mutations or rearrangements . At the transcript level, validation should include quantitative RT-PCR with primers spanning multiple exons, as well as 5' and 3' RACE to identify potential alternative transcripts that might emerge as compensatory mechanisms. Protein-level validation is critical and should employ multiple antibodies targeting different Ubac2 epitopes in Western blot analysis, along with mass spectrometry confirmation to verify complete absence of the protein in knockout models or correct expression of modified protein in knockin models . Functional validation should assess changes in ubiquitination patterns of known or predicted Ubac2 substrates, along with phenotypic characterization across multiple systems potentially affected by Ubac2 dysfunction. To account for potential genetic compensation effects, researchers should consider generating acute Ubac2 depletion models (e.g., using degron approaches) alongside traditional knockout models, comparing acute versus chronic loss to distinguish direct effects from adaptive responses . Finally, all validated mouse models should be carefully preserved through sperm or embryo cryopreservation and detailed protocols should be published to ensure reproducibility and resource sharing within the research community.

What can comparative proteomics teach us about the evolution of Ubac2 and its role in ubiquitination pathways?

Comparative proteomics analyses across evolutionary diverse species reveal that Ubac2 emerged relatively early in eukaryotic evolution, with recognizable orthologs present in most metazoans but notably absent in fungi and plants, suggesting a specialized role in multicellular animal biology . Examination of domain architecture conservation shows that the defining ubiquitin-associated domain (UBA) of Ubac2 has remained remarkably stable across evolutionary history, while flanking regions show greater diversification, potentially reflecting adaptation to species-specific regulatory mechanisms or interaction partners. Analysis of selection pressure across Ubac2 coding sequences indicates strong purifying selection at the core functional residues involved in ubiquitin binding, with accelerated evolution at potentially regulatory regions, particularly in the lineages leading to mammals . When mapping Ubac2 into the broader context of ubiquitination machinery across species, it becomes apparent that Ubac2 expansion and diversification correlates with increasing complexity of the ubiquitination system as a whole, with higher numbers of E1, E2, and E3 enzymes in more complex organisms like mice and humans compared to invertebrates . Interaction network reconstruction across model organisms suggests that while core Ubac2 functions may be conserved, its integration into specific cellular pathways shows species-specific elaboration, particularly in vertebrates where it appears to have acquired additional roles in specialized tissues. Comparing post-translational modification patterns of Ubac2 across species reveals evolutionary acquisition of new regulatory sites in mammals, particularly phosphorylation sites that may enable integration with signaling networks that evolved later in evolutionary history . These comparative proteomic insights provide crucial context for interpreting experimental findings in model organisms and extrapolating to human biology, helping researchers distinguish conserved, fundamental functions of Ubac2 from species-specific adaptations.

How should researchers approach cross-species validation of Ubac2 findings from mouse models?

When approaching cross-species validation of Ubac2 findings from mouse models, researchers should implement a systematic translational framework that begins with comprehensive sequence and structural comparison of Ubac2 between mice and the target species (typically human) to identify regions of high conservation that likely maintain functional equivalence across species . Critical mouse findings should be validated in human cell lines using complementary approaches such as CRISPR-based manipulation of the human UBAC2 gene alongside rescue experiments with mouse Ubac2 to test functional interchangeability. For interaction studies, researchers should verify key Ubac2 protein-protein interactions identified in mouse systems using human proteins, employing techniques like co-immunoprecipitation, proximity labeling, or yeast two-hybrid assays with both species' proteins to identify conserved and divergent interaction partners . When examining regulatory mechanisms, cross-species comparison of promoter regions, enhancers, and transcription factor binding sites can reveal conserved control elements that likely maintain similar expression patterns across species, while identification of species-specific regulatory elements may explain divergent expression patterns. To validate physiological relevance, researchers should analyze Ubac2 expression data from human tissues corresponding to mouse tissues where significant phenotypes were observed, utilizing publicly available databases like GTEx alongside directed expression studies in relevant human samples . For disease-related findings, human genetic association studies examining UBAC2 variants in conditions that phenocopy mouse model pathologies can provide powerful validation, while testing mouse-derived therapeutic approaches targeting Ubac2 on patient-derived cells or organoids offers translational validation. Throughout this cross-species validation process, researchers should maintain awareness of fundamental differences in immune systems, metabolism, and cellular physiology between mice and humans that might influence Ubac2 function and carefully document both consistent and divergent findings to advance translational understanding .

What are the potential applications of Ubac2 research in understanding human disease pathways?

Ubac2 research has significant potential applications in understanding human disease pathways, particularly in conditions involving dysregulated protein homeostasis and ubiquitination processes . Neurodegenerative disorders such as Alzheimer's, Parkinson's, and Huntington's diseases feature abnormal protein aggregation and defective clearance mechanisms, making Ubac2's role in ubiquitin-mediated protein degradation potentially relevant to disease mechanisms and therapeutic development. Cancer biology represents another critical application area, as ubiquitination pathways regulate numerous oncogenes and tumor suppressors; understanding Ubac2's specific contributions to these regulatory networks could reveal novel diagnostic biomarkers or therapeutic targets . In immunological disorders, particularly autoimmune conditions, Ubac2 research may provide insights into aberrant immune signaling, as ubiquitination plays crucial roles in regulating immune receptor signaling, cytokine production, and inflammatory responses. Metabolic disorders represent another promising application domain, as early research suggests links between Ubac2 and metabolic regulation, potentially connecting to conditions like obesity, diabetes, and metabolic syndrome through effects on energy metabolism and insulin signaling pathways . Developmental disorders may also benefit from Ubac2 research, especially if Ubac2 proves critical for embryonic development or specific organogenesis processes where precise protein regulation through ubiquitination is essential. For developing therapeutic approaches, Ubac2-related research could inform strategies for targeted protein degradation technologies like PROTACs (Proteolysis Targeting Chimeras), which hijack the ubiquitin-proteasome system to eliminate disease-causing proteins . As research progresses, patient stratification based on Ubac2 expression patterns or genetic variants might enable more personalized approaches to diseases involving ubiquitination pathway dysregulation, improving treatment outcomes through targeted interventions specific to particular molecular subtypes.

How can researchers leverage genetic code expansion techniques to develop novel Ubac2-targeted therapeutics?

Researchers can leverage genetic code expansion (GCE) techniques to develop novel Ubac2-targeted therapeutics through a multi-faceted approach that begins with precise structural mapping of Ubac2's functional domains and interaction interfaces . By incorporating photo-crosslinking unnatural amino acids at predicted interaction sites, researchers can capture and identify transient or weak binding partners of Ubac2 in living cells, revealing potential therapeutic intervention points within its interaction network. GCE enables the creation of site-specifically modified Ubac2 variants with incorporated biophysical probes to screen for small molecules that induce conformational changes or disrupt critical protein-protein interactions, facilitating structure-based drug design targeting specific Ubac2 functions . For developing protein-based therapeutics, GCE allows production of Ubac2 variants with precisely positioned conjugation handles for attaching cell-penetrating peptides, targeting moieties, or stability-enhancing polymers, improving their pharmacological properties while maintaining functional specificity. Researchers can employ GCE to generate synthetic Ubac2-ubiquitin conjugates with defined linkage types that mimic natural intermediates in ubiquitination pathways, serving as tools to identify compounds that selectively modulate specific aspects of Ubac2 function without broadly disrupting the ubiquitination system . For validating therapeutic approaches in animal models, GCE enables development of "chemical knockout" strategies where engineered Ubac2 variants containing specific GCE-introduced modifications can be selectively degraded by small molecules, allowing temporal control over Ubac2 depletion to evaluate therapeutic potential . When targeting disease-associated Ubac2 variants, GCE techniques can generate protein versions containing disease-specific mutations alongside proximity-based sensors, creating platforms for high-throughput screening of compounds that specifically correct abnormal interactions or functions of these disease variants while sparing normal Ubac2 activity.

What emerging technologies should researchers consider for future Ubac2 research?

For future Ubac2 research, researchers should consider emerging single-cell technologies that enable unprecedented resolution of Ubac2 expression and function at the individual cell level, revealing heterogeneity in ubiquitination processes across cell populations and identifying specialized cell types where Ubac2 plays particularly critical roles . Advanced proteomics approaches utilizing ion mobility mass spectrometry and top-down proteomics will allow more complete characterization of Ubac2 proteoforms, including combinatorial post-translational modifications that may regulate its function in different cellular contexts. Spatial omics technologies combining in situ sequencing or imaging mass spectrometry with traditional histology will provide critical insights into the subcellular localization and tissue distribution of Ubac2 and its interaction partners, revealing microenvironmental influences on its function . For studying dynamic processes, researchers should adopt advanced live-cell imaging techniques such as lattice light-sheet microscopy combined with split fluorescent protein systems to visualize Ubac2 interactions with unprecedented spatiotemporal resolution in living cells. Emerging synthetic biology approaches, including engineered ubiquitination cascades with optogenetic control, will allow precise manipulation of Ubac2 activity with light, enabling researchers to dissect its functions with exceptional temporal precision . Computational advances in artificial intelligence and machine learning should be applied to integrate diverse Ubac2 datasets and predict functional impacts of genetic variants or potential therapeutic interventions, while improved protein structure prediction algorithms will provide more accurate models of Ubac2 structure to guide experimental design . As CRISPR technologies continue to evolve, base editing and prime editing techniques will enable precise introduction of specific Ubac2 variants without double-strand breaks, while tissue-specific in vivo CRISPR screens will systematically reveal contextual dependencies on Ubac2 function . Collectively, these emerging technologies will transform our understanding of Ubac2 biology by providing multi-dimensional insights at unprecedented resolution and scale, potentially revealing new applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.