Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 4 (Adck4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Coq8b; Adck4; Atypical kinase COQ8B, mitochondrial; AarF domain-containing protein kinase 4; Coenzyme Q protein 8B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-533
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Coq8b
Target Protein Sequence
MWLELGAMLRRTCGPLGRAVRLPCGGALGPRPHWWGPCRSCLAQSVHQDQPGRGLSEDDI RRAREARLRKAPRPQLSDRSRERKVPASRISRLASFGGLAVGLGLGALAEVTKKSLPGGS LQHEGVSGLGSSPFLSEANAERIVQTLCTVRGAALKIGQMLSIQDNSFISPQLQRIFERV RQSADFMPRWQMMRVLEEELGKDWQDKVASLEEVPFAAASIGQVHQGLLKDGTEVAVKIQ YPGVAQSIQSDVENLLALLKMSVGLPEGLFAEQSLQTLQQELAWECDYRREAACAQTFRK LLADDPFFRVPAVVQELCTTRVLGMELAGGIPLDQCQGLSQDIRNQICFQLLRLCLRELF EFRFMQTDPNWANFLYDASSHQVTLLDFGASRAFGTEFTDHYIEVVKAAADGDRDRVLQK SQDLKFLTGFETKAFSDAHVEAVMILGEPFAASGPYDFGAGETARRIQGLIPVLLRHRLR PPPEETYALHRKLAGAFLACARLHAHIACRDLFQDTYHRYWASRQTLPLPAAS
Uniprot No.

Target Background

Function
Adck4 is an atypical kinase involved in coenzyme Q (ubiquinone) biosynthesis, a crucial lipid-soluble electron transporter in aerobic cellular respiration. While its precise substrate specificity remains unclear, it lacks protein kinase activity. It likely functions as a small molecule kinase, potentially a lipid kinase phosphorylating a prenyl lipid within the ubiquinone biosynthesis pathway. Adck4 is also essential for podocyte migration.
Database Links
Protein Families
Protein kinase superfamily, ADCK protein kinase family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Cytoplasm, cytosol. Cell membrane.

Q&A

What is the primary function of Adck4 in mice?

Adck4 is primarily required for coenzyme Q10 (CoQ10) biosynthesis and mitochondrial function. Research using mouse models has demonstrated that Adck4 is essential for maintaining podocyte health and kidney function. Studies with podocyte-specific Adck4 knockout mice have shown that loss of Adck4 leads to significantly decreased CoQ10 levels, reduced respiratory chain activity, diminished mitochondrial potential, and dysmorphic mitochondria with loss of cristae formation . These effects can be rescued by treatment with 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of the CoQ10 precursor molecule, confirming that these phenotypes are attributable to decreased CoQ10 levels .

At the molecular level, Adck4 interacts with multiple mitochondrial proteins, including COQ5, and also with cytoplasmic proteins such as myosin and heat shock proteins. Knockout of Adck4 has been shown to decrease COQ complex levels, suggesting that Adck4 plays a role in stabilizing the CoQ biosynthetic complex .

What are the expression patterns of Adck4 in mouse tissues?

Adck4 exhibits tissue-specific expression patterns with notable presence in kidney tissues, particularly in glomerular podocytes. Research has demonstrated that podocyte-specific deletion of Adck4 in mice results in severe kidney pathology, indicating the critical importance of this protein in podocyte function . While the search results don't provide comprehensive expression data across all tissues, the lethality of whole-body Adck4 knockout in mice (as reported by the International Mouse Phenotyping Consortium) suggests essential functions in multiple tissues during development .

Researchers studying tissue-specific expression should consider employing immunohistochemistry with validated antibodies against Adck4, quantitative PCR for transcript expression analysis, or reporter mouse models where fluorescent proteins are expressed under the control of the Adck4 promoter.

How is Adck4 structurally and functionally related to other ADCK family proteins?

Adck4 belongs to the aarF domain-containing kinase family and shows high similarity to Adck3, which has also been implicated in CoQ10 biosynthesis . The ADCK family proteins contain conserved domains that are characteristic of atypical kinases. Sequence analysis reveals that Adck4 contains an aarF domain that is evolutionarily conserved across species.

When designing experiments to study Adck4 function, researchers should consider the potential functional redundancy between Adck4 and other family members, particularly Adck3. Comparative analysis of sequence conservation, protein domain structure, and functional assays between family members can provide insights into unique and shared functions of Adck4.

What are the recommended methods for generating recombinant mouse Adck4 for in vitro studies?

For producing recombinant mouse Adck4, researchers should consider the following approach:

  • Gene cloning: Clone the full-length mouse Adck4 cDNA into an appropriate expression vector with a tag for purification (e.g., FLAG, His-tag). Based on published methodologies, researchers have successfully used p3XFLAG vectors for expressing ADCK4 .

  • Expression system selection: For mammalian expression, HEK293 cells have been successfully used to express FLAG-tagged ADCK4 for interaction studies . For bacterial expression, codon optimization may be necessary.

  • Protein purification: Use affinity chromatography based on the chosen tag. For FLAG-tagged Adck4, FLAG M2 agarose beads incubated with cell lysates (75 mg protein from HEK293 cells expressing p3XFLAG-ADCK4) for 48 hours at 4°C with orbital shaking has been effective. Washing four times with lysis buffer minimizes non-specific binding, and elution can be performed using 200 μL of buffer containing 150 ng/μL 3xFLAG peptide .

  • Validation: Confirm protein identity and activity using Western blotting, mass spectrometry, and functional assays for kinase activity or CoQ10 biosynthesis.

What are effective strategies for generating Adck4 knockout mouse models?

Several approaches have been successfully employed to generate Adck4 knockout models:

  • Global knockout: Research indicates that whole-body deletion of Adck4 in mice is embryonically lethal, consistent with reports from the International Mouse Phenotyping Consortium . This suggests essential developmental functions.

  • Conditional knockout: For studying tissue-specific functions, Cre-loxP systems have been effectively utilized. The published research describes generation of podocyte-specific Adck4 knockout mice (Nphs2.Cre+;Adck4flox/flox, referred to as Adck4ΔPodocyte) by crossing Nphs2-Cre+ mice with Adck4flox/flox mice where two loxP sites flank exons 5 and 6 of the Adck4 gene .

  • CRISPR/Cas9 approach: For cellular models, CRISPR/Cas9-mediated deletion of exon 6 of the ADCK4 gene has been successfully implemented in human podocytes and HK2 cells .

When designing knockout strategies, consider:

  • Targeted exons (exons 5-6 have been successfully targeted)

  • Confirmation methods (genotyping PCR, immunoblotting)

  • Potential compensation by other ADCK family members

  • Developmental timing of knockout induction for conditional models

What functional assays are recommended for evaluating Adck4 activity and its impact on cellular processes?

To comprehensively assess Adck4 function, consider the following assays:

  • CoQ10 level measurement: Liquid chromatography-mass spectrometry (LC-MS) can be used to quantify both CoQ9 and CoQ10 levels in cellular and tissue samples. Studies have shown that ADCK4 knockout results in decreased CoQ9 in both cultured podocytes and HK-2 cells, while CoQ10 reduction was observed specifically in podocytes .

  • Mitochondrial function assessment:

    • Respiratory chain activity measurements

    • Mitochondrial membrane potential assays

    • Electron microscopy to assess mitochondrial morphology (particularly cristae formation)

    • ATP production assays

  • Protein-protein interaction studies: Immunoprecipitation followed by mass spectrometry has identified Adck4 interactors. FLAG-tagged Adck4 pull-down experiments followed by LC-MS/MS analysis have successfully identified interaction partners .

  • Proteomic analysis: iTRAQ (isobaric tag for relative and absolute quantification) methodology has been effectively used to characterize proteome changes in ADCK4 knockout cells, revealing differentially expressed proteins in various cellular pathways .

  • Glomerular function assessment: For kidney-focused studies, assess:

    • Podocyte marker expression (podocin, nephrin, synaptopodin)

    • Basement membrane integrity

    • Filtration slit frequency

    • Albuminuria and proteinuria measurements

How does Adck4 deficiency affect the stability and function of the CoQ complex in mitochondria?

Research demonstrates that Adck4 plays a crucial role in maintaining CoQ complex stability. In Adck4 knockout podocytes, the levels of CoQ complex components are significantly decreased . The mechanism appears to involve direct interaction between Adck4 and CoQ biosynthetic components, particularly COQ5. Importantly, overexpression of ADCK4 in ADCK4 knockout podocytes rescues the reduced COQ5 level, indicating that Adck4 directly contributes to CoQ complex stability .

For researchers investigating this relationship, consider:

  • Co-immunoprecipitation studies: To identify physical interactions between Adck4 and CoQ complex components.

  • Blue native PAGE: To assess intact CoQ complex assembly and stability in wild-type versus Adck4-deficient mitochondria.

  • Pulse-chase experiments: To determine if Adck4 affects the turnover rate of CoQ complex components.

  • Structural studies: To elucidate how Adck4 might stabilize the complex through direct binding or post-translational modifications.

  • Enzymatic activity assays: To measure the functional output of CoQ biosynthetic enzymes in the presence and absence of Adck4.

What is the relationship between Adck4 deficiency and inflammatory or autoimmune conditions?

Emerging research suggests potential connections between Adck4 dysfunction and inflammatory conditions. A case report has documented a patient presenting with both Crohn's disease and ADCK4 glomerulopathy (ADCK4-GN) . This association raises important questions about the mechanistic link between mitochondrial dysfunction due to CoQ10 deficiency and inflammatory processes.

Researchers exploring this relationship should consider:

  • Inflammatory marker profiling: Measure proinflammatory cytokines, chemokines, and acute phase proteins in Adck4-deficient models.

  • Immune cell function: Assess the activation status and function of immune cells (macrophages, T cells, B cells) in Adck4 knockout models.

  • Oxidative stress assessment: Measure ROS production, antioxidant enzyme activities, and oxidative damage markers, as mitochondrial dysfunction often leads to oxidative stress that can trigger inflammation.

  • Response to anti-inflammatory therapies: Evaluate whether treatments such as infliximab (which was effective in the reported Crohn's disease case with ADCK4-GN) modulate the phenotype of Adck4 deficiency models .

  • Pathway analysis: Proteomic studies in ADCK4 knockout podocytes have indicated that proteins related to cellular defense response were upregulated, while those associated with cytokine production were downregulated , suggesting complex effects on inflammatory pathways that warrant further investigation.

What are the most accurate mouse models for studying ADCK4-associated glomerulopathy?

The podocyte-specific Adck4 knockout mouse (Nphs2.Cre+;Adck4flox/flox) represents an effective model for studying ADCK4-associated glomerulopathy. These mice develop a phenotype that closely resembles the human condition, characterized by:

  • Progressive kidney disease: Mice exhibit increased morbidity with age, including hunched posture and seedy fur .

  • Histopathological features: Development of severe focal segmental glomerular sclerosis with extensive interstitial fibrosis and tubular atrophy, similar to the human disease .

  • Ultrastructural changes: Electron microscopy reveals effacement of podocyte foot processes and reduced filtration slit frequency .

  • Molecular abnormalities: Decreased expression of slit diaphragm proteins (podocin, nephrin) and primary process markers (synaptopodin), with increased expression of basement membrane and fibrotic markers .

  • Response to therapy: Treatment with 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of CoQ10 precursor, prevents the development of kidney disease in this model .

For researchers developing or selecting mouse models, consider:

  • Age of disease onset and progression (phenotypes develop over 10 months)

  • Appropriate controls (littermates without Cre expression)

  • Methods for quantifying disease severity (albuminuria, BUN, creatinine levels)

  • Potential for complementary in vitro models using CRISPR/Cas9-mediated ADCK4 knockout in podocyte cell lines

How effective are CoQ10 supplementation and precursor therapies in treating Adck4 deficiency?

Treatment with CoQ10 or its precursor compounds shows promising efficacy in ameliorating Adck4 deficiency phenotypes:

  • In vivo efficacy: Treatment with 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of the CoQ10 precursor, prevented the development of severe focal segmental glomerular sclerosis, interstitial fibrosis, and tubular atrophy in podocyte-specific Adck4 knockout mice .

  • Cellular rescue: In ADCK4 knockout podocytes, 2,4-diHB treatment rescued multiple phenotypes including:

    • Restored CoQ10 levels

    • Improved respiratory chain activity

    • Normalized mitochondrial membrane potential

    • Restored mitochondrial morphology including cristae formation

These findings strongly suggest that bypassing the biosynthetic defect through precursor supplementation is an effective therapeutic strategy for Adck4 deficiency.

Researchers investigating therapeutic approaches should consider:

  • Comparative efficacy of direct CoQ10 supplementation versus precursor compounds

  • Optimal dosing regimens and delivery methods for different model systems

  • Timing of intervention (preventive versus therapeutic after disease onset)

  • Combination therapies targeting both CoQ10 deficiency and downstream effects

What is the relationship between Adck4 deficiency and other mitochondrial disorders?

Adck4 deficiency represents a specific form of primary CoQ10 deficiency that shares features with other mitochondrial disorders but also has distinct characteristics:

  • Shared pathophysiology: Like many mitochondrial disorders, Adck4 deficiency results in:

    • Impaired electron transport chain function

    • Reduced ATP production

    • Abnormal mitochondrial morphology

    • Tissue-specific manifestations despite ubiquitous expression

  • Distinctive features:

    • Strong tropism for kidney podocytes, resulting in predominant renal phenotypes

    • Specific deficit in CoQ10 biosynthesis rather than general mitochondrial dysfunction

    • Rescue by CoQ10 precursors without requiring complete mitochondrial biogenesis

For researchers studying the intersection of Adck4 deficiency with other mitochondrial disorders:

  • Compare transcriptomic and proteomic profiles between Adck4 deficiency and other mitochondrial disorders

  • Investigate potential synergistic effects when Adck4 deficiency co-occurs with other mitochondrial defects

  • Assess whether standard mitochondrial disease treatments (such as antioxidants, metabolic modifiers) are effective for Adck4 deficiency

What are the key considerations when interpreting conflicting data about Adck4 function across different experimental systems?

Researchers may encounter conflicting results when studying Adck4 across different experimental systems. Key considerations for reconciling such discrepancies include:

  • Tissue-specific effects: The data show that ADCK4 knockout decreases CoQ10 specifically in podocytes but not in HK-2 renal tubular cells, despite reducing CoQ9 in both cell types . This highlights that Adck4 function and importance may vary dramatically across cell types.

  • Species differences: When comparing mouse Adck4 studies with human ADCK4 data, consider evolutionary differences in CoQ metabolism. Mice predominantly produce CoQ9 while humans primarily produce CoQ10.

  • Compensatory mechanisms: Different experimental systems may have varying abilities to compensate for Adck4 loss through upregulation of other pathways or proteins, particularly other ADCK family members.

  • Methodological variations:

    • Knockdown versus knockout approaches may yield different results

    • Acute versus chronic loss of function models

    • Differences in assay sensitivity for measuring CoQ levels and mitochondrial function

  • Context-dependent functions: The research shows that ADCK4 interacts with both mitochondrial and cytoplasmic proteins , suggesting multiple functions that may be differentially affected across experimental systems.

What are the most sensitive techniques for detecting and measuring changes in CoQ levels in Adck4-deficient models?

Accurate CoQ measurement is critical for Adck4 research. Recommended techniques include:

  • High-Performance Liquid Chromatography (HPLC): Can be coupled with:

    • Electrochemical detection

    • UV detection

    • Mass spectrometry (most sensitive and specific)

  • Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS): Provides both high sensitivity and specificity for distinguishing between CoQ homologs (CoQ9 vs. CoQ10) and measuring absolute quantities.

  • Sample preparation considerations:

    • Lipid extraction methods significantly impact recovery

    • Internal standards (typically deuterated CoQ) improve quantification accuracy

    • Tissue-specific extraction protocols may be necessary

  • Normalization methods:

    • Total protein content

    • Cell number

    • Tissue weight

    • Mitochondrial content markers

  • Detection limits: Consider that basal CoQ levels vary significantly between tissues and cell types. The research indicates that podocytes have approximately three-fold higher basal CoQ10 levels than HK-2 cells , which may affect the ability to detect changes in different models.

How can researchers effectively assess the impact of Adck4 on the entire CoQ biosynthetic pathway?

To comprehensively evaluate how Adck4 affects the entire CoQ biosynthetic pathway:

  • Metabolomic profiling: Analyze intermediates in the CoQ biosynthetic pathway to identify specific steps affected by Adck4 deficiency.

  • Enzyme activity assays: Measure the activities of other CoQ biosynthetic enzymes in Adck4-deficient backgrounds to determine whether Adck4 has regulatory effects beyond its direct interactions.

  • Protein complex analysis: Use techniques such as blue native PAGE, co-immunoprecipitation, and proximity labeling to assess how Adck4 deficiency affects the formation and stability of the CoQ biosynthetic complex.

  • Gene expression analysis: Determine whether Adck4 deficiency triggers compensatory transcriptional responses in other CoQ biosynthetic genes.

  • Functional complementation: Test whether overexpression of other components of the CoQ biosynthetic pathway can rescue Adck4 deficiency phenotypes.

  • CoQ biosynthesis rate measurements: Use isotope labeling to measure the rate of de novo CoQ synthesis in normal versus Adck4-deficient cells.

What are emerging techniques that could advance our understanding of Adck4 function?

Several cutting-edge approaches hold promise for deeper insights into Adck4 biology:

  • Cryo-electron microscopy: Could reveal the structural basis of Adck4's interactions with the CoQ biosynthetic complex and how mutations disrupt these interactions.

  • Single-cell omics: Single-cell transcriptomics and proteomics could reveal cell-type specific responses to Adck4 deficiency, particularly important given the heterogeneity of effects observed across cell types.

  • Organoid models: Kidney organoids derived from stem cells with CRISPR-edited ADCK4 mutations could provide a more physiologically relevant system than 2D cell culture for studying podocyte-specific effects.

  • In vivo imaging: Development of fluorescent probes for CoQ or reporter systems for CoQ biosynthesis could enable real-time monitoring of the pathway in living cells and tissues.

  • Interactome mapping: Techniques such as BioID or APEX proximity labeling could provide more comprehensive mapping of Adck4's protein interaction network in different cellular compartments.

  • Computational modeling: Systems biology approaches could help integrate diverse datasets to model how Adck4 functions within the broader network of mitochondrial metabolism and cell signaling.

What is the potential role of Adck4 in diseases beyond kidney disorders?

While current research has focused primarily on Adck4's role in kidney disease, there is emerging evidence for broader implications:

  • Inflammatory bowel disease: A case report has documented a patient with both ADCK4 glomerulopathy and Crohn's disease, suggesting potential connections between Adck4 dysfunction and gastrointestinal inflammation .

  • Mitochondrial disorders: As a protein involved in CoQ10 biosynthesis, Adck4 deficiency could contribute to a spectrum of mitochondrial disorders affecting high-energy demanding tissues.

  • Neurological conditions: Given the importance of mitochondrial function in neurons, Adck4 dysfunction might have implications for neurological health, though this remains to be investigated.

  • Metabolic diseases: The role of mitochondrial function in metabolic regulation suggests potential contributions of Adck4 to disorders of energy metabolism.

Researchers exploring these connections should consider:

  • Cross-disciplinary collaborations

  • Comprehensive phenotyping of Adck4-deficient models beyond kidney-specific manifestations

  • Genetic association studies in patient cohorts with various diseases

  • Tissue-specific conditional knockout models targeting different organ systems

How might gene therapy approaches be developed for ADCK4-associated disorders?

Gene therapy represents a promising frontier for addressing ADCK4-associated disorders at their genetic root:

  • Delivery vectors: Consider:

    • Adeno-associated virus (AAV) vectors with tropism for affected tissues

    • Lentiviral vectors for ex vivo modification of patient-derived cells

    • Nanoparticle-based delivery systems with tissue-targeting capabilities

  • Therapeutic strategies:

    • Gene replacement: Delivery of functional ADCK4 cDNA

    • Gene editing: CRISPR-based correction of specific mutations

    • RNA therapy: Antisense oligonucleotides to modulate splicing or expression

  • Target tissues:

    • For kidney disease, podocyte-targeted delivery will be critical

    • Systemic delivery may be necessary for multisystem manifestations

  • Timing considerations:

    • The progressive nature of ADCK4-associated glomerulopathy suggests earlier intervention may be more effective

    • Developmental timing for targeting congenital manifestations

  • Considerations for preclinical testing:

    • The podocyte-specific Adck4 knockout mouse model provides a relevant system for testing therapeutic efficacy

    • Patient-derived induced pluripotent stem cells differentiated into affected cell types could provide human-specific models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.