Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 5 (Adck5)

Shipped with Ice Packs
In Stock

Description

Production Parameters

Recombinant Adck5 is synthesized using cell-free systems, prokaryotic (E. coli), or eukaryotic hosts (e.g., HEK293, Sf9 cells). Below is a comparison of production methods:

Host SystemPurityTagApplication SuitabilitySource
E. coli≥85% (SDS-PAGE)His, GSTBiochemical assays, ELISA
HEK293 Cells>90% (Bis-Tris PAGE)NoneWestern blot, immunoprecipitation
Baculovirus/Sf9 Cells>75% (SDS-PAGE)GSTKinase activity studies
Wheat GermN/AGSTIn vitro binding assays

Note: Purity is typically assessed via SDS-PAGE or Bis-Tris PAGE .

Functional and Research Applications

While Adck5’s role in signaling pathways remains ambiguous, it is implicated in coenzyme Q biosynthesis and mitochondrial function . Below are validated applications:

ApplicationDetailsRelevant Sources
Western Blot (WB)Detection in murine brain tissue using rabbit polyclonal antibodies .
ELISASandwich assays for quantifying Adck5 in murine samples .
Blocking AssaysControl fragment (aa 110–202) for antibody specificity validation .
Gene-Chemical StudiesModulation of expression by environmental toxins (e.g., arsenic, bisphenol A) .

Key Insights

  • Pathway Involvement: Adck5 may interact with mitochondrial proteins involved in energy production, though its enzymatic activity is unconfirmed .

  • Gene Regulation: Exposure to chemicals like cisplatin, bisphenol A, or arsenic alters Adck5 mRNA/protein levels, suggesting stress-responsive regulation .

Unresolved Questions

  1. Kinase Activity: No substrates have been identified, and catalytic activity remains speculative .

  2. Protein Interactions: Limited data on binding partners, though potential interactions with NOTCH2NL or DLG4 are theorized .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Adck5; Uncharacterized aarF domain-containing protein kinase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Adck5
Target Protein Sequence
MWRPMRLCHFHSTLLQSRQKPWPCPAIFFRRNFKSPPARTSRARLLWRRALSATVVGTPF LLGAYYFMAEASERRKLRLAVDGIGRFGRSVKIGLFISTDYWWCTNVVLRGVEENSPKYV EIMSACHQRAADALVAGAIRNGGLYVKLGQGLCSFNHLLPTEYIQTLRVLEDKALTRGFR EVDELFLEDFQALPNELFQEFDYEPMAAASLAQVHRAKLHDGTDVAVKVQYIDLRDRFDG DVQTLELLLRLVELMHPSFGFSWVLQDLKGTLVQELDFENEGRNAERCAQELKHFHYVVI PRVHWDRSSKRVLTADFCNGCKVNDMEGIKSQGLAVQDVAKKLIQTFAEQIFHTGFIHSD PHPGNVLVRKGPDGKAELVLLDHGLYQFLDEKDRSSLCQLWRAIILRDNAAMKKHAAALG VQDYMLFSEVLMQRPVRLGQLWGSHLISREEAAYMQDMAREHFDGIMEVLKALPRPMLLV LRNINTVRAINSNLGTPVDRYFLMAKSAVWGWSRLVGAAYQGIYGSSLLRHIKVLWEALK FEMALRLEILAMRLTALMLRVLVRLGFAPKAEAEEVYQYLEM
Uniprot No.

Target Background

Function

The function of this recombinant mouse uncharacterized aarF domain-containing protein kinase 5 (Adck5) remains unclear. Its protein kinase activity and preferred phosphorylation substrate (Ser, Thr, or Tyr) are currently unknown.

Database Links
Protein Families
Protein kinase superfamily, ADCK protein kinase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the current understanding of mouse ADCK5's biological function?

ADCK5 (aarF domain containing kinase 5) is a member of the AarF domain-containing kinase family whose precise function remains largely uncharacterized. Current evidence suggests it likely enables protein serine/threonine kinase activity and participates in phosphorylation pathways . While its exact substrate specificity remains unknown, structural analysis suggests it possesses a glycine-rich region capable of binding nucleoside triphosphates, similar to other kinases in this family . Mouse ADCK5 shares approximately 81% sequence identity with human ADCK5, suggesting conserved functional roles across species . Unlike some better-characterized members of the ADCK family involved in coenzyme Q biosynthesis, ADCK5's specific cellular functions are still being investigated.

How is mouse ADCK5 gene expression regulated in normal tissues?

Mouse ADCK5 expression patterns show tissue-specific variation under normal physiological conditions. According to transcriptomic datasets, ADCK5 exhibits moderate expression across several tissue types with notable enrichment in certain regions. The regulatory mechanisms controlling ADCK5 expression involve both transcriptional and post-transcriptional processes that remain incompletely understood. Unlike the closely related adenylate kinase 5 (AK5), which shows brain-specific expression patterns , ADCK5 appears to have a broader tissue distribution. Researchers investigating ADCK5 regulation should consider examining tissue-specific transcription factors, potential enhancer elements, and epigenetic modifications that may contribute to its expression pattern.

What is known about the protein structure and domains of mouse ADCK5?

Mouse ADCK5 is a 582-amino acid protein that contains the characteristic aarF domain found in this kinase family . Its structure includes:

  • A predicted kinase domain with potential ATP-binding capabilities

  • Regions that may facilitate protein-protein interactions

  • Possible membrane-association motifs, as the protein is predicted to localize to cellular membranes

The protein's three-dimensional structure has not been fully resolved through crystallography or cryo-EM techniques, limiting our understanding of its precise molecular mechanisms. Comparative structural analysis with other ADCK family members suggests the presence of conserved catalytic residues typical of protein kinases, though experimental validation of its kinase activity remains pending .

What are the recommended approaches for expressing and purifying recombinant mouse ADCK5?

Successful expression and purification of recombinant mouse ADCK5 can be achieved through multiple expression systems, each with distinct advantages:

E. coli Expression System:

  • Most efficient for producing the full-length mouse ADCK5 (1-582 amino acids) with His-tag

  • Typical yields range from 1-5 mg/L of culture

  • Optimal induction conditions: 0.5 mM IPTG at 18°C for 16-18 hours

  • Purification via Ni-NTA affinity chromatography followed by size exclusion chromatography

Mammalian Expression Systems:

  • Recommended for studies requiring post-translational modifications

  • HEK293 cells provide good expression levels with more native-like protein folding

  • Typically tagged with His or GST for purification purposes

Key considerations for successful purification include:

  • Using protease inhibitor cocktails throughout the purification process

  • Maintaining sample temperature at 4°C to prevent degradation

  • Including 5-10% glycerol in buffer solutions to enhance protein stability

  • Performing quality control via SDS-PAGE and Western blotting using anti-ADCK5 antibodies

For researchers investigating potential kinase activity, it's advisable to avoid phosphatase inhibitors during early characterization experiments to prevent interference with activity assays.

What methods are most effective for studying ADCK5's potential kinase activity?

Investigating ADCK5's putative kinase activity requires a multi-faceted approach:

In vitro Kinase Assays:

  • Radiometric assays using [γ-32P]ATP to detect phosphorylation of potential substrates

  • Non-radiometric methods including fluorescence-based assays (e.g., ADP-Glo™)

  • Western blotting with phospho-specific antibodies following in vitro reactions

Substrate Identification:

  • Protein array screening with recombinant ADCK5 and ATP to identify potential substrates

  • Co-immunoprecipitation experiments to capture physiologically relevant binding partners

  • Phosphoproteomic analysis comparing wild-type and ADCK5-depleted cellular systems

Important Controls:

  • Kinase-dead mutants (typically K→A mutation in the ATP-binding site)

  • ATP-binding site competitive inhibitors

  • Phosphatase treatment of substrates prior to assay

Unlike some well-characterized kinases, ADCK5's substrate specificity remains undefined. Preliminary evidence suggests it may function as a serine/threonine kinase , but researchers should design experiments to test multiple substrate classes. The interaction of ADCK5 with proteins like NOTCH2NL, Dlg4, and RHOD provides starting points for substrate identification studies.

How can I effectively design gene knockdown or knockout experiments for mouse ADCK5?

Designing effective genetic manipulation experiments for ADCK5 requires careful consideration of the approach and appropriate controls:

RNA Interference (RNAi):

  • Most effective siRNA sequences target the coding region of ADCK5

  • Recommended concentration: 10-50 nM with 48-72 hour incubation

  • Essential controls: non-targeting siRNA, mock transfection, and untransfected cells

  • Validation: qRT-PCR and western blotting to confirm knockdown efficiency

CRISPR-Cas9 Gene Editing:

  • Multiple sgRNA design tools can identify efficient guide sequences

  • Targeting early exons increases likelihood of functional knockout

  • Single-cell cloning and validation is essential for complete knockout studies

  • Phenotypic rescue experiments with wild-type ADCK5 expression confirm specificity

Conditional Knockouts for in vivo Studies:

  • Flox/Cre systems allow tissue-specific or inducible deletion

  • Careful consideration of appropriate Cre driver lines based on research question

  • Monitoring for potential compensatory mechanisms by related kinases

For studying ADCK5 in cancer contexts, such as its role in lung cancer metastasis through the ADCK5-SOX9-PTTG1 pathway , it's crucial to select cell lines that express detectable levels of ADCK5 and pathway components. Validation studies should include assessment of downstream effectors to confirm functional consequences of ADCK5 manipulation.

What is known about ADCK5's role in cancer progression and metastasis?

ADCK5 has emerging significance in cancer biology, particularly in the context of lung cancer:

Lung Cancer Metastasis:

  • ADCK5 has been implicated in promoting invasion and migration of lung cancer cells through the ADCK5-SOX9-PTTG1 pathway

  • Studies suggest altered mitochondrial functionality in metastatic lung cancer may involve ADCK proteins, including ADCK5

Expression in Cancer Types:

  • The Cancer Genome Atlas (TCGA) data shows variable ADCK5 expression across different cancer types

  • Copy number variations and mutations in ADCK5 have been documented in several cancer types

Potential Mechanisms:

  • ADCK5 may influence cellular energetics through its kinase activity

  • Interaction with proteins like NOTCH2NL suggests potential involvement in signaling pathways relevant to cancer progression

  • Possible roles in regulating mitochondrial function, which is frequently altered in cancer cells

Research investigating ADCK5's role in cancer should consider both cell-autonomous effects and potential influences on the tumor microenvironment. The correlation between ADCK5 expression levels and clinical outcomes deserves further investigation to determine its value as a prognostic marker or therapeutic target.

How does mouse ADCK5 compare with human ADCK5 in terms of expression patterns and disease associations?

Understanding the similarities and differences between mouse and human ADCK5 is crucial for translational research:

Sequence Homology:

  • Mouse ADCK5 shares approximately 81% sequence identity with human ADCK5

  • Key functional domains show higher conservation than peripheral regions

Expression Pattern Comparison:

  • Both species show broadly similar tissue distribution patterns

  • Species-specific differences in relative expression levels across tissues exist

Disease Associations:

  • Human ADCK5 has been linked to cancer progression pathways

  • Mouse models have been used to study these associations, with generally consistent findings

  • Some pathway interactions may be species-specific

Regulatory Mechanisms:

  • Promoter regions show both conserved and divergent elements

  • Some transcription factor binding sites are preserved across species

What are the current hypotheses regarding ADCK5's role in mitochondrial function and cellular metabolism?

Advanced research into ADCK5 is exploring several hypotheses regarding its potential roles in mitochondrial biology:

Mitochondrial Functionality:

  • Other ADCK family members are known to regulate mitochondrial processes

  • Altered mitochondrial functionality in metastatic lung cancer may involve ADCK5

  • Potential roles in regulating mitochondrial translation or replication

Metabolic Regulation:

  • ADCK5 may influence cellular energy homeostasis through phosphorylation of key metabolic enzymes

  • Possible involvement in AMP-activated protein kinase (AMPK) signaling networks

  • Potential regulation of mitochondrial respiratory complex assembly or activity

Research Directions:

  • Metabolomic profiling comparing wild-type and ADCK5-deficient cells

  • Respirometry assays to assess effects on oxidative phosphorylation

  • Investigation of interactions with known mitochondrial regulatory proteins

  • Assessment of mitochondrial morphology and dynamics in ADCK5-manipulated systems

The association of other ADCK family proteins with coenzyme Q biosynthesis suggests potential roles for ADCK5 in related pathways. Researchers should consider employing techniques such as proximity labeling (BioID, APEX) to identify the mitochondrial interactome of ADCK5 and elucidate its functional roles.

What experimental approaches can resolve conflicting data regarding ADCK5's substrate specificity?

The uncharacterized nature of ADCK5's kinase activity has led to conflicting reports regarding its substrate specificity. Resolving these discrepancies requires sophisticated experimental approaches:

Comprehensive Substrate Profiling:

  • Kinase substrate microarrays with diverse peptide libraries

  • Phosphoproteomic analysis comparing wild-type and ADCK5-knockout/knockdown systems

  • In vitro kinase assays with candidate substrates identified through interactome studies

Structural Biology Approaches:

  • X-ray crystallography or cryo-EM of ADCK5 alone and in complex with substrate candidates

  • Molecular dynamics simulations to predict substrate binding modes

  • Mutagenesis studies of putative substrate-binding residues

Cellular Validation Strategies:

  • Proximity-dependent labeling to identify physiologically relevant substrates

  • Phospho-specific antibodies against putative phosphorylation sites

  • Rescue experiments with phosphomimetic or phospho-dead substrate mutants

Potential Confounding Factors:

  • ADCK5 may function as a pseudokinase or have non-canonical kinase activity

  • Its activity may require specific cellular contexts or co-factors

  • Redundancy with other kinases may mask phenotypes in single-gene studies

For researchers encountering conflicting data, it's advisable to employ multiple complementary techniques and validate findings across different cellular systems and experimental conditions.

What are the most promising therapeutic applications targeting ADCK5 in disease contexts?

Based on emerging research, several therapeutic strategies targeting ADCK5 show potential:

Cancer Therapeutics:

  • Small molecule inhibitors targeting ADCK5 kinase activity

  • Disruption of the ADCK5-SOX9-PTTG1 pathway in lung cancer

  • Combination approaches with mitochondrial-targeting drugs for synergistic effects

Biomarker Development:

  • ADCK5 expression or activation status as prognostic indicators

  • Monitoring ADCK5 pathway activity to predict treatment response

Therapeutic Modalities:

  • Direct inhibitors of catalytic activity

  • Disruptors of protein-protein interactions

  • Targeted protein degradation approaches (PROTACs)

Challenges and Considerations:

  • Limited knowledge of off-target effects due to ADCK5's uncharacterized function

  • Potential redundancy with other kinases may require combination approaches

  • Tissue-specific roles may necessitate targeted delivery strategies

The most promising immediate direction appears to be in oncology, particularly for lung cancer where ADCK5 has been implicated in invasion and metastasis . Advanced researchers should consider developing conditional animal models with tissue-specific ADCK5 modulation to evaluate therapeutic potential while minimizing systemic effects.

What are the optimal antibodies and detection methods for mouse ADCK5 in various applications?

Selecting appropriate antibodies and detection methods is crucial for reliable ADCK5 research:

Recommended Antibodies:

  • For Western blotting: Anti-ADCK5 polyclonal antibodies raised against recombinant fragments

  • For immunoprecipitation: Monoclonal antibodies targeting conserved epitopes

  • For immunohistochemistry: Validated antibodies with confirmed specificity in knockout tissues

Detection Strategies:

  • Western blotting: 7.5-10% SDS-PAGE gels provide optimal resolution

  • Immunofluorescence: Fixation with 4% paraformaldehyde preserves epitope accessibility

  • Flow cytometry: Permeabilization required for intracellular detection

Validation Approaches:

  • Parallel analysis with multiple antibodies targeting different epitopes

  • ADCK5 knockdown/knockout controls to confirm specificity

  • Blocking experiments using recombinant ADCK5 protein fragments

Common Technical Challenges:

  • Cross-reactivity with other ADCK family members

  • Variable detection sensitivity across different tissues

  • Potential epitope masking due to protein-protein interactions

For researchers working with mouse ADCK5, it's advisable to use recombinant mouse ADCK5 protein standards for antibody validation and assay optimization, rather than relying solely on human ADCK5 standards due to the 19% sequence divergence .

How can I design experiments to investigate ADCK5's potential interactions with other proteins and signaling pathways?

Investigating ADCK5's protein interactions and signaling pathway involvement requires methodical experimental design:

Interaction Identification Methods:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening with ADCK5 as bait

  • Proximity-dependent labeling (BioID, APEX) in relevant cellular compartments

  • In silico prediction based on structural modeling and sequence analysis

Validation Approaches:

  • Reciprocal co-immunoprecipitation experiments

  • FRET or BiFC for direct interaction visualization in living cells

  • Protein fragment complementation assays

  • Surface plasmon resonance or isothermal titration calorimetry for binding kinetics

Pathway Analysis:

  • Phosphoproteomic analysis following ADCK5 manipulation

  • Transcriptomic profiling to identify downstream effectors

  • Small molecule inhibitor studies targeting candidate pathways

  • Genetic epistasis experiments to establish pathway hierarchy

Known Interaction Partners to Investigate:

  • NOTCH2NL: Implicated in neuronal development and potentially cancer

  • Dlg4: Involved in synaptic signaling and scaffold functions

  • RHOD: Regulates cytoskeletal dynamics and cell migration

  • HSPA6: Heat shock protein involved in cellular stress responses

  • TNS2: Tensin family member with roles in cell adhesion

  • Junb: Transcription factor with roles in cellular proliferation

When designing interaction studies, researchers should consider both constitutive and condition-specific interactions, as ADCK5's binding partners may vary depending on cellular context, stress conditions, or disease states.

What computational approaches are advancing our understanding of ADCK5 function?

Computational methods are increasingly important for elucidating ADCK5's functions:

Structural Prediction and Analysis:

  • AlphaFold2 and RoseTTAFold predictions of ADCK5 structure

  • Molecular dynamics simulations to identify potential active sites

  • Virtual screening for potential binding partners or inhibitors

Network-Based Approaches:

  • Integrated analysis using platforms like INDRA to construct interaction networks

  • Gene co-expression analysis across tissues and disease states

  • Pathway enrichment analysis to identify functional contexts

Machine Learning Applications:

  • Prediction of potential substrates based on sequence features

  • Classification of disease associations through multi-omics data integration

  • Identification of regulatory elements controlling ADCK5 expression

Data Integration Frameworks:

  • Multi-omics approaches combining genomic, transcriptomic, and proteomic data

  • Analysis of ADCK5 alterations across The Cancer Genome Atlas (TCGA) datasets

  • Comparative genomics across species to identify evolutionarily conserved functions

These computational approaches provide testable hypotheses that can guide experimental design, particularly for an understudied protein like ADCK5. The integration of experimental validation with computational predictions represents a powerful strategy for rapid functional characterization.

How is ADCK5 research contributing to our understanding of mitochondrial dysfunction in disease?

ADCK5 research is expanding our knowledge of mitochondrial biology in disease contexts:

Cancer Metabolism:

  • Altered mitochondrial functionality in metastatic lung cancer involves pathways potentially linked to ADCK5

  • Changes in mitochondrial membrane potential associated with metastatic phenotypes

  • Irregular mitochondrial morphology with bridging and membrane structure loss in metastases

Research Implications:

  • Compounds inhibiting mitochondrial translation or replication show enhanced effects on metastasis-derived cells

  • Phenformin treatment reduces metastasis development in vivo, suggesting therapeutic potential

  • ADCK family proteins may serve as biomarkers for mitochondrial dysfunction in cancer

Methodological Advances:

  • Electron microscopy techniques for visualizing mitochondrial ultrastructure changes

  • Metabolic flux analysis to quantify alterations in mitochondrial function

  • Genome-scale shRNA library screens identifying mitochondria-associated genes in metastasis

What are the current limitations in ADCK5 research and how might they be addressed?

Several significant challenges currently limit ADCK5 research progress:

Knowledge Gaps:

  • Incomplete understanding of physiological substrates and binding partners

  • Limited characterization of tissue-specific functions and expression patterns

  • Unclear relationship between ADCK5 and other ADCK family members

Technical Challenges:

  • Lack of highly specific antibodies and detection reagents

  • Difficulty in producing active recombinant protein for enzymatic studies

  • Limited availability of genetic models for in vivo functional analysis

Experimental Approaches to Address Limitations:

  • Development of conditional knockout mouse models for tissue-specific studies

  • Application of CRISPR-Cas9 screens to identify synthetic lethal interactions

  • Generation of monoclonal antibodies against specific ADCK5 epitopes

  • Development of activity-based probes for detecting active ADCK5

  • Implementation of organoid systems to study ADCK5 in physiologically relevant contexts

Research Community Needs:

  • Standardized reagents and protocols for ADCK5 detection and manipulation

  • Centralized database of ADCK5-related findings across model systems

  • Collaborative networks to accelerate functional characterization

Addressing these limitations requires multidisciplinary approaches and potentially the development of novel methodologies. Given ADCK5's potential significance in cancer and other diseases, investment in overcoming these research barriers could yield valuable insights for basic biology and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.