Recombinant Mouse Uncharacterized protein C10orf35 homolog

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Uncharacterized Protein C10orf35 Homolog

Recombinant Mouse Uncharacterized protein C10orf35 homolog is a protein that, as the name suggests, has not been extensively characterized in scientific literature . Identifying its function and interactions can provide valuable insights into cellular processes and potential therapeutic applications . The term "recombinant" indicates that the protein is produced using recombinant DNA technology, involving cloning the gene encoding the protein into a suitable expression vector and expressing it in a host cell . The "C10orf35 homolog" signifies that this protein is similar in sequence to a protein encoded by the C10orf35 gene in another organism .

Gene and Protein Characteristics

The C10orf35 gene is found in various organisms, and the mouse homolog shares similarities with the human FAM241B (family with sequence similarity 241 member B) . The human homolog of CG30159 is C3orf33, which has been identified as a regulator of the extracellular signal-regulated kinase (ERK) . Analysis of the protein sequence of C11orf96, a different uncharacterized protein, shows a CDS region of 372 bp long, encoding 124 amino acids, and is relatively conserved in different mammals . Bioinformatics analysis found that C11orf96 is rich in Ser and has multiple predicted phosphorylation sites and is associated with several transmembrane family proteins and zinc finger proteins .

  • N-terminal Region: The N-terminal region within the protein may be important, with a possible N-myristoylation site and several phosphorylation sites .

Expression and Localization

The uncharacterized protein C11orf96 is distributed in all tissues and organs, with the highest expression levels in the kidney, indicating that C11orf96 may play a specific biological role in the kidney .

Potential Functions and Interactions

  • FAME Interactions: Factor Associated with Metabolism (FAME) shows a strong association with the catalytic complex, intracellular protein transport, mitochondrial inner membrane, respiratory electron transport, and protein export . There is co-localization of genes specific for the microtubule, mitochondria, and PCP-pathway association of the FAME protein .

  • C11orf96 Interactions: C11orf96 may interact with proteins such as ZNF331, TM4SF19, CDCA7L, MARCH4, TMCO3, TMEM106C, and TMEM117 . MARCH4 is a E3 ubiquitin-protein ligase that is predicted to mediate ubiquitination of MHC-I and CD4 and promote their subsequent endocytosis and sorting to lysosomes through multivesicular bodies . CDCA7L plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter and is involved in apoptotic signaling pathways . TMEM117 is involved in ER stress-induced cell death pathway . ZNF331 may be involved in transcriptional regulation .

Relevance to Disease

Structural homology screens reveal proteins with unique combinations of domains that viruses capture from host genes and combine in unique ways, which may have implications for disease mechanisms .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please inform us; we will prioritize fulfilling your request.
Synonyms
Fam241b; Protein FAM241B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fam241b
Target Protein Sequence
MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGPGPRQQQAGARLGAAQ SPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
Uniprot No.

Target Background

Function

May play a role in lysosome homeostasis.

Database Links
Protein Families
FAM241 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing Recombinant Mouse C10orf35 homolog?

Expression systems significantly impact protein quality and functionality. For recombinant mouse proteins, several expression systems are commonly used, each with specific advantages:

  • Yeast Expression Systems (e.g., Pichia pastoris): Typically yields proteins with superior folding and post-translational modifications compared to bacterial systems. This system allows for natural folding patterns that more closely resemble those in mammalian cells, making it ideal for complex proteins requiring proper folding .

  • E. coli Expression Systems: More suitable for smaller, less complex proteins that don't require extensive post-translational modifications. While offering high yields and cost-effectiveness, proteins may lack proper folding or modification patterns .

  • NS0 and Mammalian Cell Expression Systems: Recommended for recombinant proteins requiring complex post-translational modifications or when structural integrity is critical for functional studies .

When selecting an expression system for C10orf35 homolog, consider the protein's size, complexity, and intended application. For uncharacterized proteins, comparative studies using multiple expression systems may be necessary to determine optimal conditions.

What are the recommended reconstitution and storage protocols for C10orf35 homolog?

Proper reconstitution and storage are critical for maintaining protein activity:

Reconstitution Protocol:

  • Allow the lyophilized protein to reach room temperature before opening the vial

  • Reconstitute in sterile phosphate-buffered saline (PBS) to a concentration of 100-200 μg/mL

  • Gently mix by swirling or inverting; avoid vigorous vortexing which can cause protein denaturation

  • For proteins without carrier proteins, inclusion of at least 0.1% carrier protein (such as BSA) in the reconstitution buffer is recommended

Storage Recommendations:

  • Store reconstituted protein in single-use aliquots to avoid repeated freeze-thaw cycles

  • Store at -20°C for short-term use (1-2 weeks) or -80°C for long-term storage

  • Use a manual defrost freezer to prevent temperature fluctuations

  • Document all freeze-thaw cycles during experimental protocols

The lyophilized form generally maintains stability when stored at -20°C with desiccant, while reconstituted proteins should be used immediately or properly aliquoted and frozen .

What is the significance of carrier-free formulations for experimental applications?

Carrier-free (CF) formulations of recombinant proteins provide specific advantages in certain research applications:

Carrier proteins like Bovine Serum Albumin (BSA) are typically added to recombinant proteins to:

  • Enhance protein stability

  • Increase shelf-life

  • Allow for storage at more dilute concentrations

  • Performing protein conjugation reactions

  • Developing antibodies against the target protein

  • Conducting functional assays where carrier proteins might interfere with results

  • Running mass spectrometry analyses

  • Performing crystallography studies

For uncharacterized proteins like C10orf35 homolog, carrier-free formulations are particularly valuable during initial characterization studies to prevent experimental artifacts from carrier proteins. When using carrier-free formulations, increased attention to protein stability is necessary, often requiring optimization of buffer conditions.

How can I validate the identity and purity of Recombinant Mouse C10orf35 homolog?

Multiple complementary approaches should be used to confirm protein identity and purity:

Validation Methods:

  • SDS-PAGE Analysis: Assess protein purity and molecular weight; expect >95% purity for research-grade recombinant proteins

  • Western Blot Analysis: Confirm identity using specific antibodies if available

  • Mass Spectrometry: For precise molecular weight determination and sequence verification

  • N-terminal Sequencing: Verify the first 10-15 amino acids match the expected sequence

  • Functional Assays: Develop activity-based assays to confirm biological function

Quality Assessment Parameters:

  • Endotoxin levels should be below detection limits (<0.1 EU/μg protein)

  • Absence of other protein contaminants

  • Batch-to-batch consistency in molecular weight and activity

For uncharacterized proteins, establishing a comprehensive validation protocol is essential to ensure experimental reproducibility.

What experimental design principles should be applied when characterizing an uncharacterized protein like C10orf35 homolog?

Characterizing an uncharacterized protein requires robust experimental design following these principles:

Systematic Approach:

  • Begin with bioinformatic analysis to predict structural domains, potential functions, and evolutionary relationships

  • Design experiments with appropriate statistical power to detect meaningful biological effects

  • Incorporate multiple controls and replicates to address variability

  • Use a factorial design approach to examine multiple variables simultaneously

  • Consider dependent and independent variables carefully when designing assays

Experimental Design Table for C10orf35 Homolog Characterization:

Experimental ApproachKey Variables to ControlOutcome MeasurementsStatistical Considerations
Protein-protein interaction studiesTemperature, pH, salt concentrationBinding affinity, interaction partnersReplicate measurements (n≥3), negative controls
Subcellular localizationCell type, expression level, fixation methodLocalization pattern, co-localization with known markersQuantitative image analysis, multiple cell lines
Functional assaysConcentration range, time points, cellular contextActivity metrics relevant to predicted functionDose-response analysis, time-course studies
Gene expression effectsTreatment duration, protein concentrationTranscriptomic changesMultiple testing correction, pathway analysis

The experimental design should be hypothesis-driven while remaining flexible enough to accommodate unexpected findings that may emerge during characterization of novel proteins .

How can I determine the optimal concentration range for in vitro studies with C10orf35 homolog?

Determining the effective concentration range for an uncharacterized protein requires a systematic dose-finding approach:

Methodology:

  • Preliminary Range-Finding: Begin with a broad concentration range (typically 0.1-1000 ng/mL) based on known effective concentrations of functionally similar proteins

  • ED50 Determination: Establish dose-response curves to identify the half-maximal effective concentration

  • Cellular Toxicity Assessment: Determine the concentration threshold for non-specific cellular effects

  • Comparative Analysis: Reference effective concentrations of other recombinant mouse proteins (for example, AgRP C-terminal fragment typically shows bioactivity at 0.025-0.15 μg/mL in specific assays)

Optimization Approach:

  • Use at least 8-10 concentration points, spaced logarithmically

  • Include proper vehicle controls

  • Measure multiple outcome parameters when possible

  • Validate findings across different cell types or experimental systems

When working with uncharacterized proteins, a wider range of concentrations should initially be tested to capture potential biological activities that might not be predicted based on sequence analysis alone.

How can gene expression studies enhance our understanding of C10orf35 homolog function?

Gene expression studies provide valuable insights into protein function, particularly for uncharacterized proteins:

Integration of Gene Expression with Protein Characterization:

  • Transcriptomic Analysis: Identify genes differentially expressed in response to the recombinant protein treatment

  • Pathway Analysis: Map affected genes to biological pathways to infer potential functions

  • Comparative Approach: Compare expression profiles between in vitro and in vivo systems to identify consistent patterns

  • Temporal Dynamics: Evaluate time-dependent changes in gene expression following protein treatment

Methodological Framework:

  • Combine cell culture studies with animal models to strengthen translational relevance

  • Use appropriate tissue or cell types relevant to the predicted function

  • Include proper experimental controls and biological replicates

  • Apply statistical methods that account for multiple testing and biological variability

For uncharacterized proteins like C10orf35 homolog, correlating gene expression changes with functional assays can reveal potential biological roles and interaction networks, as demonstrated in studies with other proteins like isoflavones where gene expression analysis in white blood cells and adipose tissue provided insights into molecular effects .

What approaches should be used to investigate potential binding partners of C10orf35 homolog?

Identifying binding partners is essential for understanding protein function, particularly for uncharacterized proteins:

Complementary Approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Immobilize purified C10orf35 homolog protein on an affinity matrix

    • Incubate with cell lysates from relevant mouse tissues

    • Wash extensively to remove non-specific binders

    • Identify bound proteins by mass spectrometry

    • Validate key interactions by reciprocal pulldowns

  • Proximity Labeling Techniques:

    • Generate fusion proteins with BioID or APEX2

    • Express in relevant cell types

    • Identify proximal proteins through biotinylation

    • Validate spatial relationships by microscopy

  • Surface Plasmon Resonance (SPR):

    • Measure direct binding kinetics with candidate partners

    • Determine association and dissociation constants

    • Compare binding parameters with related proteins

  • Yeast Two-Hybrid Screening:

    • Create a bait construct with C10orf35 homolog

    • Screen against mouse tissue-specific libraries

    • Validate positive interactions in mammalian systems

When investigating potential binding partners, it's critical to perform careful control experiments and validate hits through orthogonal methods to minimize false positives.

How should I analyze contradictory data about C10orf35 homolog function across different experimental systems?

Contradictory data is common when characterizing novel proteins and requires systematic analysis:

Resolution Framework:

  • Methodological Examination:

    • Compare protein preparation methods (expression systems, purification protocols)

    • Evaluate differences in assay conditions (buffer composition, temperature, pH)

    • Assess cell line or animal model variations

    • Consider the impact of carrier proteins or tags on protein function

  • Biological Context Analysis:

    • Determine if contradictions arise from different cellular contexts

    • Investigate concentration-dependent effects that may explain divergent results

    • Consider the impact of post-translational modifications on protein function

    • Evaluate the presence of cofactors or binding partners in different systems

  • Experimental Design Considerations:

    • Apply principles from the design of experiments (DOE) to systematically explore factors contributing to variability

    • Design experiments that can directly test competing hypotheses

    • Use multiple complementary approaches to address the same question

  • Statistical Analysis:

    • Apply appropriate statistical tests to determine if differences are significant

    • Consider statistical power when evaluating negative results

    • Implement meta-analytical approaches when combining data across studies

For uncharacterized proteins, contradictions often reflect genuine biological complexity rather than experimental artifacts and may provide valuable insights into context-specific functions.

What are the emerging applications of uncharacterized proteins like C10orf35 homolog in biomedical research?

Uncharacterized proteins represent an important frontier in biomedical research, with several emerging applications:

Research Frontiers:

  • Biomarker Development: Uncharacterized proteins like C10orf35 have shown potential as biomarkers for specific conditions, as noted in studies where C10orf35 was used as a biomarker in conjunction with cigarette and alcohol research

  • Novel Therapeutic Targets: Functional characterization of previously uncharacterized proteins has revealed new potential intervention points for disease treatment

  • Evolutionary Biology: Comparative studies of uncharacterized protein homologs across species provide insights into evolutionary conservation and divergence of protein function

  • Systems Biology Integration: Uncharacterized proteins fill critical gaps in our understanding of cellular networks and pathways, enabling more comprehensive modeling of biological systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.