Recombinant Mouse Uncharacterized protein C12orf59 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem52b; Transmembrane protein 52B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-186
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem52b
Target Protein Sequence
EENCVNTEHCLTTDWVHLWYIWLLVVVGALLLLCGLTSVCFRCCLSRPENGEDGAPPPYE VTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHAHSSLGQLPSSVDTLPGYEEALRMS RFTVARCGQKVPDLPSVPEEKQLPPTGKESPGTEPPSH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the C12orf59 protein and where is it normally expressed?

C12orf59 (Chromosome 12 open reading frame 59) is a gene first cloned in 2002, localized on Chromosome 12p13.2 in humans. The protein is broadly expressed in normal human tissues with particularly high expression levels in kidney tissue. The mouse homolog shares significant sequence conservation with the human variant, suggesting important biological functions . Research indicates it may encode transmembrane proteins and is associated with RNA-binding protein HuR .

What are the optimal storage conditions for recombinant C12orf59 protein?

Recombinant mouse C12orf59 homolog should be stored in Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended storage. To maintain protein stability, avoid repeated freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week . Proper storage is essential for maintaining protein structure and function during experimental protocols.

What detection methods are most effective for C12orf59 expression analysis?

Multiple detection methods have been validated for C12orf59 expression analysis:

  • RT-PCR: Effective for mRNA quantification using specific primers (C12orf59-F: 5′-CAGCACTCTCCAGAGCACTATCA-3′ and C12orf59-R: 5′-TGGCTACTGTGAAGCGACTCAT-3′)

  • Western blotting: For protein detection, though specific antibody dilutions may need optimization

  • Immunohistochemistry: Successfully used with anti-C12orf59 primary antibody (1:100 dilution; Sino Biological)

The relative expression level can be determined using the 2^-ΔΔCt method with appropriate housekeeping genes such as β-actin .

How do expression patterns of C12orf59 differ between normal tissues and cancer models?

Research shows complex, context-dependent expression patterns for C12orf59:

In contrast, in esophageal tissue: C12orf59 shows elevated expression in esophageal squamous cell carcinoma (ESCC) cell lines and tissues compared to normal controls .

In gastric cancer: C12orf59 was significantly upregulated and associated with poor survival outcomes .

These contradictory expression patterns suggest tissue-specific regulatory mechanisms and possibly different functional roles depending on cellular context.

What regulatory pathways control C12orf59 expression in different cancers?

Multiple regulatory mechanisms have been identified:

  • Genetic mutations: In renal cancer, C12orf59 expression correlates with VHL non-sense mutations or frame-shift mutations (P < 0.01) and UMPP gene mutations (P = 0.01) .

  • microRNA regulation: In gastric cancer, downregulation of miR-654-5p contributes to C12orf59 overexpression .

  • Transcriptional regulation: NF-κB can bind to the C12orf59 promoter, forming a positive feedback loop with CDH11 to sustain metastatic ability in gastric cancer cells .

Methodologically, researchers should design experiments that account for these multiple regulatory layers when investigating C12orf59 function.

How can researchers effectively manipulate C12orf59 expression for functional studies?

For gain- and loss-of-function studies, several validated methodologies have been employed:

  • Lentiviral overexpression: C12orf59 cDNA can be cloned into pGV lentivirus vector and transduced into target cells. Selection with 2 μg/ml puromycin has been effective for establishing stable expression .

  • RNA interference: shRNA approaches have been successful in knockdown studies. For example, MKN-45/shC12orf59 models have been developed for in vivo metastasis assays .

  • CRISPR/Cas9: While not explicitly mentioned in the provided studies, this approach represents a potential advancement for precise genetic manipulation of C12orf59.

Verification of expression changes should employ both RT-PCR and Western blotting to confirm successful manipulation at both mRNA and protein levels.

What is the relationship between C12orf59 and epithelial-mesenchymal transition in cancer progression?

Functional studies have established that C12orf59 can modulate epithelial-mesenchymal transition (EMT) in multiple cancer types:

In ESCC: C12orf59 overexpression promotes cell proliferation, migration, and invasion by inducing EMT through Yes-associated protein (YAP) dephosphorylation and nuclear translocation .

In gastric cancer: C12orf59 similarly promotes invasion and metastasis through EMT induction, forming a C12orf59/NF-κB/CDH11 feedback loop that sustains metastatic capacity .

Methodologically, researchers should assess EMT markers (E-cadherin, N-cadherin, vimentin) and transcription factors (Snail, Slug, ZEB1/2) when investigating C12orf59's role in cancer progression.

How do C12orf59 expression levels correlate with clinical outcomes in different cancers?

Clinical correlation studies reveal opposing prognostic associations:

In renal cell carcinoma: Decreased C12orf59 expression correlates with:

  • Lymph node metastasis (P < 0.05)

  • Distant metastases (P < 0.05)

  • Poor survival (P < 0.001, HR 3.00; 95% CI, 1.29-7.53)

This suggests a tumor-suppressive role in kidney cancer.

In contrast, in gastric cancer: Increased C12orf59 expression is associated with poor survival outcomes .

These contradictory findings highlight the importance of tissue-specific analysis when evaluating C12orf59 as a prognostic biomarker.

What experimental models are most appropriate for studying mouse C12orf59 homolog function?

Based on current literature, researchers should consider:

  • Cell culture models: While immortalized cell lines show altered C12orf59 expression, primary cell cultures may better represent physiological conditions. For the mouse homolog specifically, consider using mouse kidney cell lines or primary kidney cell cultures.

  • Mouse models: The high sequence conservation between human and mouse C12orf59 suggests mouse models may provide relevant insights. Consider both xenograft models (using manipulated cancer cell lines) and genetically engineered mouse models (knockout or conditional expression models).

  • Tissue samples: Paired tumor/normal tissue samples provide valuable clinical correlations, as demonstrated in studies showing 4.5-fold decreases in C12orf59 expression in ccRCC samples compared to adjacent normal tissues .

How can researchers reconcile contradictory findings on C12orf59 function in different cancer types?

The divergent roles of C12orf59 across cancer types present an important research challenge. Methodological approaches to address this include:

  • Comprehensive protein interaction studies: Identify tissue-specific binding partners using techniques like co-immunoprecipitation followed by mass spectrometry.

  • Pathway analysis: Employ RNA-seq or proteomics to identify differentially activated pathways in contexts where C12orf59 acts as tumor suppressor versus oncogene.

  • Domain-specific function analysis: Create truncated versions of the protein to determine if different functional domains mediate different effects.

  • Context-dependent regulation studies: Investigate how the microenvironment might influence C12orf59 function through co-culture experiments.

What statistical approaches are most appropriate for analyzing C12orf59 expression in clinical samples?

Based on published methodologies, the following statistical approaches are recommended:

P-values < 0.05 should be considered statistically significant, consistent with published literature.

What are the most pressing unanswered questions regarding mouse C12orf59 homolog?

Several critical knowledge gaps remain to be addressed:

  • Physiological function: Despite expression studies, the normal biological function of C12orf59 remains poorly understood.

  • Structure-function relationship: The protein's structural domains and their specific functions need characterization.

  • Interactome: Comprehensive protein-protein interaction studies are needed to place C12orf59 in cellular pathways.

  • Mouse-human differences: Detailed comparative studies between mouse and human orthologs would clarify translational relevance.

  • Regulatory mechanisms: Further investigation into transcriptional, post-transcriptional, and post-translational regulation could explain tissue-specific expression patterns.

What novel experimental approaches could advance understanding of C12orf59 function?

Researchers should consider these emerging methodologies:

  • Single-cell analysis: To understand heterogeneity of C12orf59 expression within tissues.

  • CRISPR screens: To identify synthetic lethal partners and downstream effectors.

  • Advanced imaging techniques: To visualize subcellular localization and trafficking.

  • Computational modeling: To predict structural features and potential binding interfaces.

  • Organoid models: To study C12orf59 function in more physiologically relevant 3D systems that better recapitulate tissue architecture and cellular interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.