Recombinant Mouse Uncharacterized protein C12orf69 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Smco3; Single-pass membrane and coiled-coil domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Smco3
Target Protein Sequence
MAQSDFLYPQNPRRRQEVNRLHQQLLDCLSDSFQVTNKLTGVLNTHLGCRLAFIEMKSDG TIKENCDIIIQAMTKIQKELQKIDEALKDQLEPTLYRKLQDIKERETEKIAIVQKVISVI LGEATSAASAVAVKLVGSSVTTGIISKLVSVLAHIGTSLLGSIGVAVLSLGIDMIIQAIL GAVERTQLQAAIKSYEKHLEEFKAASAKYHHAITEVATAVKRQLR
Uniprot No.

Target Background

Database Links

KEGG: mmu:654818

UniGene: Mm.386899

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the fundamental storage requirements for Recombinant Mouse C12orf69 homolog?

The Recombinant Mouse Uncharacterized protein C12orf69 homolog requires specific storage conditions to maintain protein integrity and biological activity. Standard storage should be at -20°C, while extended storage benefits from conservation at -20°C or -80°C . For working solutions, it is recommended to store aliquots at 4°C for a maximum of one week . Importantly, repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of functional activity .

The shelf life varies depending on storage conditions:

Storage FormTemperatureRecommended Shelf Life
Liquid-20°C/-80°C6 months
Lyophilized-20°C/-80°C12 months

These storage guidelines are critical for maintaining experimental reproducibility and validity, as protein degradation can significantly impact experimental outcomes in functional studies.

How does the mouse C12orf69 homolog relate to homologous proteins in other vertebrate species?

The mouse C12orf69 homolog represents an uncharacterized protein with potential homologs across multiple vertebrate species. Vertebrate homology databases such as those maintained by the Mouse Genome Informatics (MGI) contain comparative information between mouse, human, rat, and zebrafish homologs .

When investigating homology relationships:

  • Access the MGI database (last updated March 25, 2025) which contains comprehensive homology information

  • Use the UniProt accession number (Q8BQM7) to query homology relationships

  • Cross-reference findings with other genomic databases such as the Mouse Genome Database (MGD)

  • Examine sequence conservation across species to identify evolutionarily preserved domains that may indicate functional importance

Homology analysis provides crucial evolutionary context for uncharacterized proteins, potentially revealing functional insights based on better-characterized homologs in other species. This comparative approach helps researchers prioritize experimental directions based on conserved domains or species-specific variations that may indicate specialized functions.

What experimental design strategies are most appropriate for functional characterization of an uncharacterized protein like C12orf69 homolog?

When designing experiments to characterize the function of the uncharacterized C12orf69 homolog, researchers should implement a systematic experimental design approach that controls for variables while testing specific hypotheses about protein function.

The experimental design should follow these five key steps:

  • Define clear variables related to the protein's potential function

    • Independent variables: Protein expression levels, cellular conditions, interaction partners

    • Dependent variables: Phenotypic outcomes, cellular localization, pathway activation

  • Formulate specific, testable hypotheses based on sequence analysis and structural predictions

    • Example hypothesis: "C12orf69 homolog localizes to the plasma membrane and affects calcium signaling"

  • Design experimental treatments to manipulate independent variables

    • Overexpression systems

    • CRISPR-Cas9 knockdown/knockout models

    • Site-directed mutagenesis of key domains

  • Determine appropriate experimental groups

    • Control groups (empty vector, scrambled siRNA)

    • Treatment groups (protein expression at different levels)

    • Consider both between-subjects and within-subjects designs

  • Establish reliable measurement methods for dependent variables

    • Immunofluorescence for localization

    • Co-immunoprecipitation for interaction partners

    • Functional assays specific to predicted functions

For transmembrane proteins like C12orf69 homolog, additional considerations include membrane isolation techniques, detergent solubilization optimization, and reconstitution systems for functional studies. This methodical approach ensures that experiments generate meaningful data about the protein's function while controlling for extraneous variables.

How can mouse models be designed to study the in vivo function of C12orf69 homolog in relation to homologous recombination?

Designing mouse models to study C12orf69 homolog's potential role in homologous recombination requires careful consideration of the challenges associated with gene manipulation in mammals. Based on research with other homologous recombination factors, several strategic approaches can be implemented:

  • Address potential embryonic lethality:
    Many homologous recombination genes, when completely invalidated, lead to embryonic lethality in mammals . Therefore, conditional knockout strategies using Cre-loxP systems should be employed to restrict gene inactivation to specific tissues or developmental stages.

  • Consider the following mouse model approaches:

    • Tissue-specific knockout models using appropriate promoters

    • Inducible systems (e.g., tetracycline-responsive elements)

    • Hypomorphic alleles that reduce but do not eliminate function

    • Knock-in models with specific mutations to disrupt particular domains

  • Implement relevant phenotypic analyses:

    • Assess genomic stability using chromosome spread analysis

    • Measure DNA damage response through γH2AX immunostaining

    • Evaluate cancer predisposition through long-term survival studies

    • Analyze tissue-specific effects based on protein expression patterns

  • Include appropriate controls:

    • Heterozygous models to assess gene dosage effects

    • Wild-type littermates as baseline controls

    • Established HR-deficient models (e.g., BRCA1/2 models) for comparison

The collective insights from these approaches can establish whether C12orf69 homolog functions as a tumor suppressor gene, similar to other homologous recombination factors . When publishing results, researchers should clearly document experimental conditions, genetic backgrounds, and environmental factors to ensure reproducibility across different research groups.

What methodological approaches can address the challenges of working with transmembrane proteins like C12orf69 homolog?

Working with transmembrane proteins presents unique methodological challenges that require specialized approaches. For C12orf69 homolog, which is identified as a transmembrane protein , the following methodological strategies should be considered:

  • Protein extraction and purification:

    • Use specialized detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) for solubilization

    • Implement gradient centrifugation techniques for membrane fraction isolation

    • Consider nanodiscs or liposome reconstitution for functional studies

    • Optimize buffer conditions to maintain native conformation

  • Structural characterization:

    • Cryo-electron microscopy for three-dimensional structure determination

    • Circular dichroism to assess secondary structure elements

    • Limited proteolysis combined with mass spectrometry to identify domains

    • In silico prediction tools validated with experimental data

  • Functional analysis:

    • Develop assays specific to predicted transmembrane functions

    • Employ fluorescence-based techniques to monitor potential transport activities

    • Use patch-clamp electrophysiology if channel function is suspected

    • Implement FRET-based approaches to detect conformational changes

  • Interaction studies:

    • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

    • Split-ubiquitin yeast two-hybrid systems designed for membrane proteins

    • Co-immunoprecipitation with crosslinking to capture transient interactions

    • Fluorescence recovery after photobleaching (FRAP) for membrane dynamics

When working with the recombinant form, researchers should note that the N-terminal 10xHis-tag may influence membrane insertion or protein folding, necessitating control experiments with alternatively tagged versions or tag-free proteins to verify biological relevance of observed phenomena.

How can researchers effectively use People Also Ask data to identify knowledge gaps about C12orf69 homolog?

The People Also Ask (PAA) feature from Google search represents a valuable resource for identifying knowledge gaps and understanding common research questions about proteins like C12orf69 homolog. This data-driven approach to research question formulation follows this methodology:

  • Systematic data collection:

    • PAA results appear in over 80% of English searches, typically within the first few results

    • Collect PAA questions by performing related searches on C12orf69 homolog and similar proteins

    • Track the cascade of additional questions that appear when clicking on initial PAA items

    • Document the source websites providing answers to build a citation network

  • Analysis of question patterns:

    • Categorize questions by research themes (structure, function, pathology)

    • Identify recurring methodological questions that indicate technical challenges

    • Recognize patterns in search behavior that reveal common research trajectories

    • Compare PAA data for C12orf69 with better-characterized proteins

  • Knowledge gap identification:

    • Questions without clear answers in the PAA snippets indicate research opportunities

    • Conflicting answers from different sources highlight areas of scientific uncertainty

    • Track how questions evolve over time to identify emerging research trends

    • Use specialized PAA mining tools to comprehensively map the question landscape

This methodical approach transforms search behavior data into actionable research insights, allowing investigators to prioritize experiments that address the most pressing knowledge gaps about C12orf69 homolog, potentially accelerating functional characterization of this uncharacterized protein.

What protocols should be followed for reproducible storage and handling of the recombinant protein in experimental settings?

To ensure experimental reproducibility when working with Recombinant Mouse Uncharacterized protein C12orf69 homolog, researchers should implement a standardized protocol for storage, handling, and quality control:

  • Reception and initial processing:

    • Document the product code (CSB-CF806419MO) and batch number upon receipt

    • Verify protein integrity via SDS-PAGE before experimental use

    • Aliquot immediately to avoid repeated freeze-thaw cycles

  • Storage conditions protocol:

    • For long-term storage: Maintain at -80°C in manufacturer-recommended buffer

    • For medium-term storage: Store at -20°C for up to 6 months (liquid form) or 12 months (lyophilized form)

    • For active experiments: Keep working aliquots at 4°C for maximum one week

  • Handling procedures:

    • Thaw frozen aliquots rapidly at room temperature with gentle agitation

    • Keep on ice during experimental setup to minimize degradation

    • Use low-protein-binding tubes and pipette tips to prevent adsorptive loss

    • Centrifuge briefly before opening tubes to collect solution

  • Quality control measures:

    • Implement regular activity assays to monitor functional integrity over time

    • Document protein concentration before each experiment using consistent methods

    • Maintain control aliquots from each batch for comparative analysis

    • Record and report storage duration in experimental methods sections

Storage PurposeTemperatureMaximum DurationContainerSpecial Considerations
Long-term-80°C12+ monthsScrew-cap cryovialsAvoid frost-free freezers
Medium-term-20°C6-12 monthsMicrocentrifuge tubesDedicated freezer section
Working stock4°C1 weekLow-protein-binding tubesProtect from light

Adherence to these protocols ensures that experimental variations are not attributable to protein degradation or quality differences, thereby enhancing the reproducibility and reliability of research findings.

How can researchers interpret experimental data in the context of C12orf69 homolog's uncharacterized nature?

Interpreting experimental data for uncharacterized proteins like C12orf69 homolog presents unique challenges that require specialized analytical frameworks. Researchers should implement the following methodological approach to data interpretation:

What statistical approaches are most appropriate for analyzing experimental data from studies involving C12orf69 homolog?

When analyzing experimental data related to Recombinant Mouse Uncharacterized protein C12orf69 homolog, researchers should implement robust statistical approaches tailored to the specific experimental design and data characteristics:

  • Experimental design considerations:

    • For between-subjects designs: Use appropriate parametric or non-parametric comparative statistics

    • For within-subjects designs: Implement repeated measures analyses with appropriate correction for sphericity

    • Account for nested designs when analyzing hierarchical data (e.g., cells within tissues within organisms)

    • Calculate required sample sizes through power analysis before experimentation

  • Specific statistical methodologies:

    • For gene expression studies: Use linear mixed models with appropriate normalization

    • For interaction studies: Apply correlation analyses with correction for multiple comparisons

    • For phenotypic analyses: Implement survival analysis for time-to-event data

    • For microscopy data: Utilize spatial statistics and image quantification methods

  • Addressing biological variability:

    • Account for batch effects through appropriate experimental blocking

    • Use biological replicates (different mice) rather than technical replicates when possible

    • Consider variability introduced by the expression system (E. coli)

    • Report effect sizes alongside p-values to indicate biological significance

  • Specialized approaches for uncharacterized proteins:

    • Implement Bayesian methods when incorporating prior knowledge from homologs

    • Use dimension reduction techniques for high-dimensional datasets

    • Apply machine learning approaches to identify patterns across multiple experimental outcomes

    • Consider meta-analytic approaches when combining results across multiple studies

Data TypeRecommended Primary AnalysisSecondary ValidationVisualization Method
Expression levelsANOVA with post-hoc testsPermutation testsBox plots with individual data points
Localization dataChi-square distribution testsBootstrappingHeat maps with statistical overlay
Interaction dataCorrelation analysis with FDR correctionNetwork analysisInteraction networks with confidence indicators
Functional assaysLinear mixed modelsNon-parametric alternativesForest plots of effect sizes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.