Recombinant Mouse Uncharacterized protein C17orf62 homolog
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cybc1; Eros; Cytochrome b-245 chaperone 1; Essential for reactive oxygen species protein; Eros
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MYMQVETRTSTRLHLKRAPGIRSWSLLVGILSTGLAAAYYSGDSLGWKLFYVTGCLFVAV
QNLEDWEEAIFNKNTGKVILKTFSLYKKLLTLLRAGHDQVVVLLKDIQDVNVEEEKVRYF
GKGYMVVLRFATGFSHPLTQSAVMGRRSDVEAIAKLITSFLELHRLESPSERSQSSDSEP
DGPGGQS
Uniprot No.
Target Background
Function
This protein functions as a chaperone, essential for the stable expression of the CYBA and CYBB subunits of the cytochrome b-245 heterodimer. It regulates the phagocyte respiratory burst and is crucial for innate immunity.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
