Recombinant Mouse Uncharacterized protein C1orf115 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Uncharacterized protein C1orf115 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MTVGARLRSKAASSLVGRRPLGRSRRAGDEETDAIVEHLEGEDEDPASPDCEREEGGRRA GTPSARRVHLAALPERYDSLEEPAPGDKPKKRYRRKLKKYGKNFGKAISKGCRYIVIGLQ GFAAAYSAPFGVATSVVSFVR
Uniprot No.

Target Background

Database Links

KEGG: mmu:226777

UniGene: Mm.169542

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • What Bioinformatic Approaches Can Predict the Function of Mouse C1orf115 Homolog?

Multiple bioinformatic approaches can be employed to predict the function of uncharacterized proteins like mouse C1orf115 homolog:

  • Sequence Homology Analysis:

    • Compare protein sequence against characterized proteins using BLAST or HMM-based tools

    • Search for conserved domains using NCBI Conserved Domain Database (CDD)

  • Phylogenetic Profiling:

    • Generate a binary string representing presence (1) or absence (0) of C1orf115 homologs across species

    • Identify proteins with similar phylogenetic profiles, which likely function in the same pathway

    • Cluster similar profiles to infer functional relationships

  • Co-essentiality Analysis:

    • Analyze gene dependency patterns across cell lines

    • Identify genes with similar essentiality profiles that form functional modules

    • Infer function based on known genes within the same module

  • Structural Prediction and Analysis:

    • Generate 3D structural models using tools like AlphaFold

    • Identify potential binding sites and functional motifs

    • Compare with structures of characterized proteins

  • Integrated Network Analysis:

    • Incorporate protein-protein interaction data

    • Analyze co-expression patterns across tissues

    • Integrate genetic interaction data

These computational approaches provide complementary evidence that can guide experimental validation efforts.

  • How Can Experimental Design Approaches Optimize Soluble Expression of Recombinant C1orf115 Homolog?

Optimizing soluble expression of recombinant proteins requires systematic evaluation of multiple parameters through factorial design experiments. The following methodology is recommended:

  • Factorial Design Setup:

    • Identify key variables: induction OD, IPTG concentration, temperature, medium composition

    • Create a 2^(n-k) fractional factorial design to reduce experimental runs while maintaining statistical power

    • Include center points to detect curvature effects

  • Response Measurement:

    • Quantify cell growth (OD600)

    • Measure protein yield through appropriate activity assays or quantitative Western blotting

    • Assess solubility through fractionation of soluble and insoluble components

  • Statistical Analysis:

    • Determine statistically significant variables (p-value < 0.1)

    • Calculate main effects and interaction effects

    • Build regression models to predict optimal conditions

  • Optimization Strategy:

    • For variables with linear effects: set at extreme values based on effect direction

    • For variables with quadratic effects: find optimum through response surface methodology

    • Validate optimized conditions with triplicate experiments

A systematic approach using statistical design of experiments can achieve soluble expression levels up to 250 mg/L while reducing development time and resources .

  • What Approaches Can Be Used to Characterize the Function of Uncharacterized Mouse C1orf115 Homolog?

A comprehensive functional characterization strategy for uncharacterized proteins like C1orf115 homolog should combine multiple complementary approaches:

  • Genomic Approaches:

    • CRISPR-Cas9 knockout studies to observe phenotypic consequences

    • RNA-Seq analysis following knockout to identify affected pathways

    • ChIP-Seq if DNA-binding activity is suspected (given the high proportion of basic residues in the sequence)

  • Protein Interaction Studies:

    • Affinity purification-mass spectrometry (AP-MS) to identify binding partners

    • Yeast two-hybrid screening for binary interactions

    • Proximity labeling (BioID, APEX) to identify proteins in the same cellular compartment

  • Subcellular Localization:

    • Fluorescent protein tagging (N- and C-terminal) to determine localization

    • Immunofluorescence with specific antibodies

    • Subcellular fractionation followed by Western blotting

  • Biochemical Characterization:

    • Recombinant protein production for in vitro studies

    • Activity assays based on predicted function

    • Post-translational modification analysis

  • Evolutionary Approach:

    • Cross-species complementation studies

    • Analysis of tissue-specific expression patterns

    • Comparative phenotypic analysis in different model organisms

Integration of data from these diverse approaches enables triangulation of function for previously uncharacterized proteins.

  • How Can Co-essentiality Analysis Be Applied to Infer the Function of Mouse C1orf115 Homolog?

Co-essentiality analysis represents a powerful approach for functional inference based on genetic dependencies across cell lines:

  • Methodology:

    • Compile gene dependency scores for C1orf115 homolog across diverse cell lines

    • Calculate correlation coefficients between C1orf115 homolog and all other genes

    • Apply statistical filtering to identify significant correlations

    • Group co-essential genes into modules using clustering algorithms

  • Functional Interpretation:

    • Perform GO term enrichment analysis on co-essential modules

    • Analyze pathway enrichment to identify biological processes

    • Compare with protein complex databases to identify potential complex membership

  • Validation Approach:

    • Experimentally confirm physical interactions with predicted functional partners

    • Test for synthetic lethality with key co-essential genes

    • Perform rescue experiments with related proteins

This approach has successfully assigned functions to previously uncharacterized proteins, including identifying TMEM189 as plasmanylethanolamine desaturase and discovering C15orf57's role in regulating clathrin-mediated endocytosis .

  • What Are the Challenges in Determining Subcellular Localization of C1orf115 Homolog?

Determining subcellular localization of uncharacterized proteins presents several methodological challenges:

  • Technical Limitations:

    • Potential artifacts from protein overexpression

    • Tag interference with localization signals

    • Limited antibody availability for native protein detection

    • Resolution constraints of conventional microscopy

  • Biological Complexities:

    • Dynamic localization dependent on cellular conditions

    • Multiple isoforms with different localization patterns

    • Partial distribution across multiple compartments

    • Transient associations with different organelles

  • Methodological Solutions:

    • Compare N- and C-terminal tags to minimize interference

    • Use smaller epitope tags (HA, FLAG) if GFP disrupts localization

    • Employ super-resolution microscopy for precise localization

    • Implement live-cell imaging to capture dynamic changes

    • Use correlative light and electron microscopy for ultrastructural context

    • Apply proximity labeling methods (BioID, APEX) to map protein neighborhoods

  • Validation Approaches:

    • Perform subcellular fractionation followed by Western blotting

    • Use multiple cell types to ensure consistency

    • Compare endogenous vs. tagged protein localization patterns

    • Validate with functional assays specific to the compartment

Integrating multiple complementary approaches provides the most reliable determination of subcellular localization.

  • How Can CRISPR-Cas9 Technology Be Utilized to Study C1orf115 Homolog Function?

CRISPR-Cas9 technology offers versatile approaches for investigating uncharacterized proteins like C1orf115 homolog:

  • Knockout Studies:

    • Design gRNAs targeting early exons of the C130074G19Rik gene

    • Generate complete knockout mice via embryonic injection

    • Create cell line knockouts for in vitro functional studies

    • Analyze resulting phenotypes at molecular, cellular, and organismal levels

  • Knockin Approaches:

    • Insert reporter genes (GFP, luciferase) to monitor expression patterns

    • Add epitope tags for protein detection and purification

    • Introduce specific mutations to study structure-function relationships

  • CRISPR Screening:

    • Conduct genome-wide CRISPR screens in C1orf115 knockout background to identify synthetic lethal interactions

    • Perform focused screens targeting specific pathway components

    • Analyze genetic interactions to place C1orf115 in functional networks

  • Transcriptional Regulation:

    • Use CRISPRa (with dCas9-activators) to upregulate expression

    • Use CRISPRi (with dCas9-repressors) to downregulate expression

    • Study dosage effects on cellular phenotypes

  • Domain Analysis:

    • Create precise deletions of predicted functional domains

    • Generate chimeric proteins to test domain functions

    • Introduce point mutations in conserved residues

When designing CRISPR experiments, researchers should consider potential off-target effects, include appropriate controls, and validate editing efficiency through sequencing.

  • How Do Comparative Genomics Approaches Help in Functional Characterization of Uncharacterized Proteins?

Comparative genomics provides powerful insights into the function of uncharacterized proteins through evolutionary analysis:

  • Phylogenetic Profiling Methodology:

    • Create binary vectors representing presence/absence of homologs across species

    • Calculate profile similarity using appropriate metrics (Hamming distance, mutual information)

    • Cluster proteins with similar profiles

    • Infer functional linkage based on co-evolution patterns

  • Theoretical Framework:

    • Proteins that function together in pathways or complexes tend to be co-inherited

    • Co-evolution suggests functional dependency

    • Conservation across diverse species indicates functional importance

  • Implementation Strategy:

    • Collect homologs using sensitive sequence search methods (PSI-BLAST, HMM)

    • Select representative genomes across evolutionary space

    • Generate and compare phylogenetic profiles

    • Identify statistically significant profile similarities

  • Validation Approaches:

    • Experimental confirmation of predicted functional linkages

    • Assessment of physical interactions between co-evolved proteins

    • Testing for synthetic phenotypes upon co-deletion

This approach has successfully predicted functions for numerous uncharacterized proteins by identifying their participation in known pathways or complexes .

  • What Post-Translational Modifications Might Regulate C1orf115 Homolog Function?

While specific post-translational modifications (PTMs) of mouse C1orf115 homolog have not been experimentally characterized in detail, analysis of its sequence suggests several potential regulatory modifications:

  • Potential Phosphorylation Sites:

    • Multiple serine and threonine residues throughout the sequence

    • Potential regulatory impacts:

      • Altering protein-protein interactions

      • Changing subcellular localization

      • Modulating protein stability

  • Methodological Approaches for PTM Identification:

    • Mass spectrometry-based proteomics for global PTM profiling

    • Phospho-specific antibodies for detecting specific modifications

    • Radioactive labeling with kinase assays to identify phosphorylation sites

  • Functional Analysis Strategy:

    • Site-directed mutagenesis of predicted modification sites

    • Phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

    • Non-phosphorylatable mutations (S/T to A) to prevent phosphorylation

    • Comparison of wild-type and mutant protein properties

  • Regulatory Context Investigation:

    • Identification of kinases and phosphatases that modify C1orf115 homolog

    • Analysis of conditions that trigger changes in modification patterns

    • Study of modification dynamics during cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.