Recombinant Mouse Uncharacterized protein C1orf185 homolog

Shipped with Ice Packs
In Stock

Description

Overview

The Recombinant Mouse Uncharacterized Protein C1orf185 Homolog is a protein that corresponds to the gene C1orf185 (chromosome 1 open reading frame 185) in Mus musculus (house mouse) . The human version of C1orf185 is a poorly expressed protein sometimes found in the circulatory system .

Basic Information

FeatureDescription
NameRecombinant Full Length Mouse Uncharacterized Protein C1orf185 Homolog
OrganismMus musculus (House mouse)
TagN-terminal His tag
Expression SystemE. coli
NCBI Gene ID284546
UniProt IDQ9CPZ3
Length1-230aa
Predicted LocationMembrane

Homology

C1orf185 has orthologs (genes in different species that evolved from a common ancestral gene) across a variety of species . The following table displays C1orf185 orthologs in different species :

Genus and SpeciesCommon NameTaxonomic GroupDate of Divergence (MYA)Accession NumberSequence Length (aa)Sequence Identity (Global)Sequence Similarity (Global)
Homo sapiensHumanPrimates0NP_001129980.1199100%100%
Pongo abeliiSumatran orangutanPrimates15.76PNJ53823.119593.50%95.50%
Cebus capucinus imitatorCapuchinPrimates43.2XP_017404303.122977.00%79.60%
Galeopterus variegatusSunda flying lemurDermoptera76XP_008578352.120373.70%77.90%
Oryctolagus cuniculusRabbitLagomorpha90XP_008263491.122569.90%76.40%
Dipodomys ordiiOrd's kangaroo ratRodentia90XP_012877642.118852.20%59.40%
Mastomys couchaSouthern multimammate mouseRodentia90XP_03123403726351.50%61.50%
Mus musculusHouse mouseRodentia90NP_001186019.122647.40%59.50%
Peromyscus leucopusWhite-footed mouseRodentia90XP_028745885.129541%48.20%
Phyllostomus discolorPale spear-nosed batChiroptera96XP_028367083.119173.40%80.40%
Myotis davidiiDavid's myotisChiroptera96XP_006768446.119671.40%78.40%
Equus caballusHorsePerissodactyla96XP_023485921.124363.80%68.30%
Muntiacus muntjakIndian muntjacArtiodactyla96KAB0362285.120059.40%65.90%
Hipposideros armigerGreat roundleaf batChiroptera96XP_019487867.115754.90%59.20%
Tursiops truncatusBottlenose dolphinArtiodactyla96XP_033708766.118954.10%59.00%
Sarcophilus harrisiiTasmanian devilDasyuromorhpia159XP_031825005.133318.20%27.70%
Ornithorhynchus anatinusPlatypusMonotremata180XP_02890227130926.80%37.40%
Pelodiscus sinensisChinese softshell turtleReptilia312XP_025042106.18907.40%11.40%
Gopherus evgoodeiSinaloan thornscrub tortoiseReptilia312XP_030429802.17774.00%6.30%
Chrysemys picta belliiWestern painted turtleReptilia312XP_023960730.17483.70%5.80%

C1orf185 changes relatively quickly and is conserved only in mammals and a few turtles . Primates are the only taxonomic group that strongly conserves this gene, while other mammals and turtles heavily conserve the transmembrane domain (positions 15–37) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
Uncharacterized protein C1orf185 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MTSPNGVFSHLTYFMAAGALSLGIGFFALASALWFLICKRRELFEESKFKEFGENMKQGS CKPKLKAHPQCVFISRNFHAGYLQSQTEKREKEEAEKKAVRSHSKVEFCLQDPISCESPE VTSVANGSSVSTLSLSTSISSSYCCQTVEEAEDWLTDDCLETRIPLKNPLLGEPLKKKVL AYLSSISLEEWPGNTVSNTFCSEQKTDSLKELLVLKNTEVGKHNLQFDIE
Uniprot No.

Target Background

Database Links

KEGG: mmu:67646

UniGene: Mm.45820

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal storage and reconstitution conditions for recombinant mouse C1orf185 homolog?

For optimal stability and activity:

  • Storage: Store the lyophilized protein at -20°C to -80°C upon receipt.

  • Reconstitution: Briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Long-term storage: Add glycerol to a final concentration of 5-50% (with 50% being standard) and aliquot for long-term storage at -20°C/-80°C.

  • Handling: Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week .

The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How should I design initial characterization experiments for an uncharacterized protein like C1orf185 homolog?

When designing experiments for uncharacterized proteins, follow a systematic approach:

  • Sequence-based predictions: Begin with bioinformatic analyses of the amino acid sequence to predict:

    • Secondary structure

    • Transmembrane domains

    • Signal peptides

    • Functional domains or motifs

    • Evolutionary conservation

  • Localization studies: Determine subcellular localization using:

    • Fluorescent tagging (e.g., GFP fusion)

    • Cell fractionation followed by Western blotting

    • Immunocytochemistry (if antibodies are available)

  • Interaction studies: Identify binding partners through:

    • Co-immunoprecipitation

    • Yeast two-hybrid screening

    • Proximity labeling approaches

    • Pull-down assays using the His-tagged recombinant protein

  • Expression pattern analysis: Examine tissue/cell-specific expression patterns to infer potential biological contexts

This stepwise approach allows you to generate hypotheses about the protein's function that can be tested in subsequent experiments .

What experimental controls should be included when working with recombinant C1orf185 homolog protein?

For rigorous experimental design when working with this uncharacterized protein:

Control TypePurposeImplementation
Negative controlsRule out non-specific effectsEmpty vector; irrelevant protein with similar size/tag
Positive controlsValidate experimental systemWell-characterized protein with known activity in your assay
Tag-only controlsAccount for tag-related effectsExpress and purify the tag alone
Denatured proteinConfirm activity requires native structureHeat-inactivated or chemically denatured protein
Concentration gradientEstablish dose-dependencySerial dilutions of the recombinant protein

Additionally, include biological replicates (n≥3) and technical replicates to ensure statistical validity. When reporting results, clearly describe all controls and their outcomes to enhance reproducibility .

What approaches can be used to determine the potential function of C1orf185 homolog based on knockout studies?

The observation that C1orf185 was under-expressed in ZIP8-knockout cells suggests potential functional connections to metal ion transport pathways . To explore this relationship:

  • Comparative proteomic analysis: Compare expression profiles between wild-type and knockout models, as demonstrated in the ZIP8-KO study using iTRAQ (isobaric tags for relative and absolute quantitation) .

  • Rescue experiments: Introduce recombinant C1orf185 homolog into knockout systems to determine if any phenotypes can be rescued, which would indicate functional relevance.

  • Metal homeostasis assessment: Since C1orf185 appears connected to ZIP8 (a metal cation symporter), measure cellular metal content (particularly manganese, selenium, and zinc) in systems with varying C1orf185 expression.

  • Gene co-expression networks: Analyze transcriptomic data to identify genes with expression patterns that correlate with C1orf185, which may suggest functional associations.

  • CRISPR/Cas9 knockout: Generate C1orf185 knockout cell lines to directly observe resulting phenotypes and compare with ZIP8 knockouts for overlapping effects .

These approaches can provide valuable insights into the biological role of this uncharacterized protein and its potential involvement in metal homeostasis pathways.

How can homology modeling and cross-species comparison help characterize C1orf185 homolog?

For uncharacterized proteins like C1orf185 homolog, comparative approaches provide critical insights:

  • Evolutionary conservation analysis: Identify conserved regions across species, which often indicate functionally important domains. The mouse C1orf185 homolog corresponds to a human protein, suggesting evolutionary conservation of function.

  • Homology modeling: Use algorithms to predict tertiary structure based on proteins with similar sequences but known structures. This can reveal potential binding sites or functional domains.

  • Cross-species functional studies: Compare phenotypes resulting from manipulation of this gene across different model organisms (e.g., mouse, zebrafish, C. elegans) to identify conserved functions.

  • Ortholog and paralog analysis: Identify related proteins in other species or gene families that have been better characterized, which may suggest functional properties.

These comparative approaches are particularly valuable for uncharacterized proteins, as they leverage evolutionary relationships to infer function when direct experimental evidence is limited.

How should researchers address solubility and stability issues when working with recombinant C1orf185 homolog?

Uncharacterized proteins often present unpredictable handling challenges. For C1orf185 homolog:

  • Solubility optimization:

    • Test multiple buffer systems (varying pH, salt concentration, and additives)

    • Consider adding low concentrations of non-ionic detergents (0.01-0.1% Triton X-100) if the protein has hydrophobic regions

    • Add stabilizing agents such as glycerol (5-10%) or reducing agents if the protein contains cysteines

  • Activity preservation:

    • Monitor protein stability using dynamic light scattering or size-exclusion chromatography

    • Test activity immediately after reconstitution and after various storage conditions

    • For function-based assays, determine optimal protein:substrate ratios empirically

  • Tag interference considerations:

    • The N-terminal His tag may affect folding or function

    • Consider tag removal using appropriate proteases if problems persist

    • Compare results with C-terminally tagged versions if available

Document all optimization steps systematically, as this information will be valuable to other researchers working with this challenging protein.

What analytical methods are most appropriate for validating the purity and integrity of recombinant C1orf185 homolog preparations?

For comprehensive quality assessment:

Analytical MethodPurposeTechnical Considerations
SDS-PAGEAssess size and initial purityUse gradient gels (4-20%) for better resolution
Western blotConfirm identityUse anti-His antibodies or specific antibodies if available
Mass spectrometryVerify sequence and modificationsBoth intact protein MS and peptide mapping approaches
Size-exclusion chromatographyDetect aggregation and oligomeric statesAnalyze elution profile compared to known standards
Circular dichroismEvaluate secondary structureConfirms proper folding and stability in different conditions
Dynamic light scatteringMeasure size distribution and aggregationParticularly useful for monitoring batch-to-batch consistency

What is the significance of C1orf185 homolog being downregulated in ZIP8-knockout cells?

The observation that C1orf185 is under-expressed in ZIP8-knockout cells suggests several important biological implications:

  • Potential functional relationship: ZIP8 (SLC39A8) is a metal cation symporter that transports essential micronutrients including manganese, selenium, and zinc . The co-regulation suggests C1orf185 homolog may:

    • Participate in metal homeostasis pathways

    • Function as a downstream effector of ZIP8-mediated processes

    • Share regulatory mechanisms with ZIP8

  • Research opportunities: This connection provides specific hypotheses to test:

    • Whether C1orf185 expression can be restored by supplementation with specific metals

    • If C1orf185 and ZIP8 physically interact or co-localize

    • Whether C1orf185 knockout produces phenotypes similar to ZIP8 deficiency

  • Disease relevance: Since ZIP8 has been implicated in various human diseases , C1orf185 may also have pathophysiological importance that warrants investigation.

This finding provides a valuable starting point for functional characterization by placing the uncharacterized protein within a specific biological context, rather than approaching its function entirely de novo.

How can next-generation techniques be applied to elucidate the function of uncharacterized proteins like C1orf185 homolog?

Advanced technologies offer powerful approaches for characterizing proteins of unknown function:

  • CRISPR screening:

    • Perform genome-wide CRISPR screens in cells expressing or lacking C1orf185 to identify genetic interactions

    • Use CRISPRi/CRISPRa to modulate expression and observe phenotypic consequences

  • Proximity-dependent biotinylation (BioID or APEX):

    • Generate fusion proteins to identify proximal interacting partners in living cells

    • Map the protein's microenvironment within cellular compartments

  • Single-cell omics:

    • Analyze single-cell transcriptomics data to identify co-expressed genes across diverse cell types

    • Correlate expression with specific cellular states or processes

  • Structural biology approaches:

    • Employ cryo-EM to determine structure without crystallization

    • Use AlphaFold or similar AI tools to predict structure with increasing accuracy

  • High-content imaging:

    • Perform phenotypic profiling using automated microscopy after C1orf185 manipulation

    • Identify subtle phenotypes that may reveal functional roles

These cutting-edge approaches can accelerate functional discovery for uncharacterized proteins like C1orf185 homolog by generating comprehensive datasets that reveal patterns and associations not apparent through traditional methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.