Recombinant Mouse protein C1orf43 homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Protein C1orf43 Homolog

Recombinant Mouse Uncharacterized protein C1orf43 homolog, also known as chromosome 1 open reading frame 43, is a protein that, when produced recombinantly, can be utilized in various research applications . The full-length mouse C1orf43 homolog protein, with the accession number Q8R092, consists of 253 amino acids. It is expressed in E. coli with an N-terminal His tag .

Cat.No. :RFL23268MF
Product Overview :Recombinant Full Length Mouse Uncharacterized protein C1orf43 homolog Protein (Q8R092) (1-253aa), fused to N-terminal His tag, was expressed in E. coli.

Production of Recombinant Proteins

Recombinant protein production involves the use of genetic engineering techniques to produce proteins in host cells such as E. coli . For example, to produce the mouse ROR1 protein, the gene coding for different segments such as the C-terminus of tetanus toxin, extracellular domain of mouse ROR1, and Fc fragment of mouse IgG2a are synthesized and inserted into a plasmid. This plasmid is then transfected into cells like CHO-K1 cells for stable expression and production of the recombinant protein . Similarly, mouse plac1 has been produced using optimized protocols in prokaryotic systems to study its immunogenic properties .

Applications in Immunological Studies

Recombinant mouse proteins, including C1orf43 homologs, are valuable in immunological research for several reasons:

  • Vaccine Development: Fusion proteins containing mouse ROR1 have been evaluated as potential cancer vaccines in mouse tumor models. These fusion proteins can induce ROR1-specific antibodies and enhance cellular immune responses, inhibiting tumor growth .

  • Antibody Production: Recombinant proteins can be used to generate antibodies. Immunizing mice with these proteins induces a humoral response, producing specific antibodies that can be used for further research .

  • Immune Response Enhancement: Studies have shown that incorporating immunostimulatory peptides into recombinant proteins, such as mouse plac1, can significantly enhance humoral immune responses, suggesting potential applications in developing more effective anti-cancer treatments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Protein C1orf43 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
N/A
Target Protein Sequence
MASSSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDTRLLQLETQGNQSCYNYLYRMKALDAIRASEIPFHAE GRHPCSLMGKNFRSYLLDLRNTSTPFKGVGKALIDTLLDGYETARYGTGVFGQSEYLRYQ EALSELATVVKARIGSSQRQHQSAAKDLTQSPEMSPTTIQVTYLPSSQKSKRPKHFLELK SFKDNYNTLESTL
Uniprot No.

Target Background

Function
A general regulator of phagocytosis; essential for the uptake of Gram-negative bacteria by macrophages.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Golgi apparatus. Mitochondrion.

Q&A

How is recombinant mouse C1orf43 homolog protein typically produced for research applications?

Recombinant mouse C1orf43 homolog protein is commonly produced using prokaryotic expression systems, with E. coli being the most frequently employed host. The process typically involves:

  • Cloning the C1orf43 coding sequence into an expression vector with an appropriate N-terminal tag (commonly His-tag)

  • Transforming the construct into competent E. coli cells

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein purification via affinity chromatography

  • Quality control testing including SDS-PAGE analysis for purity assessment

For research applications, the His-tagged full-length protein (amino acids 1-253) has been successfully expressed in E. coli systems, yielding protein with greater than 90% purity as determined by SDS-PAGE analysis . Alternative expression systems such as yeast (Pichia pastoris) might offer advantages for proteins requiring post-translational modifications, though this approach appears less common for C1orf43 homolog production based on available literature .

What storage and handling protocols are recommended for recombinant mouse C1orf43 homolog?

Optimal storage and handling of recombinant mouse C1orf43 homolog is critical for maintaining protein stability and functionality. Based on established protocols, the following guidelines should be implemented:

  • Storage conditions:

    • Long-term storage: -20°C to -80°C

    • Working aliquots: 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which significantly compromise protein integrity

  • Handling recommendations:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • For lyophilized preparations, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (final concentration 5-50%, with 50% being standard) for cryoprotection during storage

    • After reconstitution, prepare small working aliquots to minimize freeze-thaw damage

  • Buffer composition:

    • Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 provides optimal stability

These recommendations are based on empirical data from protein stability studies and reflect standard practices for maintaining recombinant protein integrity over time.

How can researchers verify the functional integrity of recombinant mouse C1orf43 homolog preparations?

Verifying functional integrity is essential when working with recombinant proteins, particularly for uncharacterized proteins like C1orf43 homolog where definitive functional assays may not be established. Researchers should implement a multi-faceted quality control approach:

  • Physicochemical characterization:

    • SDS-PAGE analysis to confirm >90% purity and expected molecular weight

    • Western blot using anti-His antibodies to verify tag presence and integrity

    • Mass spectrometry to confirm protein identity and detect potential modifications

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Size exclusion chromatography to assess aggregation status

    • Dynamic light scattering to determine size distribution

  • Functional validation:

    • Binding assays with predicted interaction partners

    • Cell-based assays comparing effects to those observed with the native protein

    • Integration with datasets from interaction studies

For reliable experimental outcomes, researchers should establish acceptance criteria for each quality parameter and maintain consistent quality control practices across experimental batches.

How can comparative genomics approaches be leveraged to study C1orf43 homolog across species?

Comparative genomics offers powerful approaches for investigating uncharacterized proteins like C1orf43 homolog by identifying conserved features and potential functions across species. Researchers can implement the following strategies:

  • Orthology mapping and conservation analysis:

    • The Alliance of Genome Resources provides harmonized orthology relationships across model organisms including mouse, human, zebrafish, and other species

    • Use DIOPT method-based orthology assertions to identify true orthologs with high confidence

    • Conduct sequence conservation analysis to identify functionally important domains

  • Integrated data analysis across model organisms:

    • Leverage cross-organism data harmonization from the Alliance database, which integrates:

      • Gene function data through Gene Ontology annotations

      • Expression patterns

      • Phenotypic data

      • Protein-protein interactions

  • Evolutionary analysis techniques:

    • Phylogenetic profiling to identify co-evolved genes

    • Synteny analysis to examine genomic context conservation

    • Positive selection analysis to identify rapidly evolving regions

The following table illustrates the scale of integrated data available for cross-species analysis in the Alliance database:

Entity or data typeNumber
Species8
Gene291,439
Synonym, identifier1,341,412
Gene-gene physical interactions1,826,673
Gene ontology (GO) annotations1,792,808
Association, gene expression1,579,792
Genomic locations8,506,484

This integrated approach can provide critical insights into the potential functions of C1orf43 homolog by identifying conserved patterns across evolutionary distance .

What systems biology approaches can be applied to understand C1orf43 homolog function?

Systems biology approaches are particularly valuable for studying uncharacterized proteins like C1orf43 homolog by placing them within larger biological networks. Researchers can employ several methodologies:

  • Data integration methodologies:

    • Use Pointillist or similar Bayesian data integration methods to combine multiple data types (transcriptomics, proteomics, interaction data)

    • Integrate protein-protein interaction data from small-scale experiments (higher confidence) with high-throughput datasets

    • Apply statistical frameworks to assign confidence scores to biological interactions

  • Network analysis approaches:

    • Construct protein interaction networks to predict C1orf43 homolog function based on the guilt-by-association principle

    • Identify network modules containing C1orf43 homolog to infer potential pathway involvement

    • Compare network topologies across species to identify conserved functional modules

  • Multi-omic data integration:

    • Combine transcriptomic, proteomic, and phenomic data to triangulate on function

    • Apply machine learning approaches to identify patterns across datasets

    • Implement Bayesian networks to model causal relationships

The strength of data integration methodologies has been demonstrated empirically, with one study showing that integration methods captured 99.8% of protein-protein interactions detected by multiple different detection methods while effectively filtering false positives . For C1orf43 homolog research, these approaches can help generate testable hypotheses about protein function despite limited direct experimental data.

What are common technical challenges when working with transmembrane proteins like C1orf43 homolog and how can they be addressed?

Working with transmembrane proteins presents unique challenges due to their hydrophobic domains and requirements for proper folding. For C1orf43 homolog, researchers should consider these challenges and solutions:

  • Solubility and proper folding:

    • Challenge: The hydrophobic transmembrane domain (evident in the N-terminal sequence) may cause aggregation during expression and purification

    • Solution:

      • Consider detergent screening (non-ionic detergents like DDM or Triton X-100)

      • Evaluate fusion partners that enhance solubility

      • Explore alternative expression systems like Pichia pastoris that may facilitate proper folding

  • Functional reconstitution:

    • Challenge: Maintaining native conformation in artificial environments

    • Solution:

      • Reconstitute in artificial lipid bilayers or nanodiscs

      • Use liposome incorporation for functional studies

      • Consider cell-free expression systems coupled with direct incorporation into membrane mimetics

  • Post-translational modifications:

    • Challenge: E. coli lacks machinery for mammalian post-translational modifications

    • Solution:

      • For studies requiring authentic modifications, consider eukaryotic expression systems like Pichia pastoris

      • Compare protein behavior from different expression systems to identify modification-dependent functions

  • Protein degradation during handling:

    • Challenge: Membrane proteins often show decreased stability

    • Solution:

      • Maintain strict temperature control during purification

      • Include protease inhibitors throughout purification

      • Use the recommended storage buffer (Tris/PBS with 6% Trehalose, pH 8.0)

Implementing these strategies can significantly improve the yield and quality of recombinant transmembrane proteins for downstream applications.

How should researchers approach data inconsistencies in C1orf43 homolog studies?

When confronted with contradictory or inconsistent results in C1orf43 homolog research, a systematic approach to data evaluation and reconciliation is essential:

  • Source validation and quality assessment:

    • Examine expression system differences (E. coli vs. yeast systems can yield proteins with different properties)

    • Evaluate protein preparation quality and purity (>90% purity by SDS-PAGE is standard)

    • Consider tag effects (His-tagged versions may behave differently than untagged versions)

  • Data integration methodology:

    • Apply Bayesian integration approaches like Pointillist to assign weights to conflicting data points

    • Use statistical frameworks to identify outliers versus genuine biological variation

    • Implement cross-validation approaches to test the robustness of findings

  • Experimental design considerations:

    • Conduct controlled side-by-side comparisons under identical conditions

    • Implement multiple orthogonal methods to test the same hypothesis

    • Design experiments that can distinguish between technical and biological variability

  • Collaboration and standardization:

    • Engage with the Alliance of Genome Resources and similar consortia to adopt standardized protocols

    • Implement common ontologies for data reporting to enhance comparability

    • Share detailed methodological information including specific reagent sources and lot numbers

When applying data integration methods, researchers should note that they can be highly effective at identifying true interactions while filtering false positives. For example, one study showed that integration methods rejected 92.9% of protein-protein interactions detected by single yeast two-hybrid assays while retaining 99.1% of interactions from small-scale experiments, which are generally considered more reliable .

What emerging technologies might advance our understanding of C1orf43 homolog function?

Several cutting-edge technologies hold promise for elucidating the function of currently uncharacterized proteins like C1orf43 homolog:

  • CRISPR-based functional genomics:

    • Genome-wide CRISPR screens to identify synthetic lethal interactions

    • CRISPRi/CRISPRa approaches for controlled modulation of C1orf43 expression

    • Base editing for introducing specific mutations to test functional hypotheses

  • Structural biology advances:

    • Cryo-EM for membrane protein structure determination without crystallization

    • Integrative structural biology combining multiple data types (crosslinking-MS, SAXS, NMR)

    • AlphaFold2 and similar AI-based structure prediction tools for hypothesis generation

  • Single-cell multi-omics:

    • Single-cell transcriptomics to identify cell populations with coordinated C1orf43 expression

    • Spatial transcriptomics to map expression in tissue context

    • Proteogenomic approaches linking genomic variation to protein abundance

  • Advanced data integration platforms:

    • Building on established data integration methodologies

    • Implementing machine learning approaches to identify patterns across heterogeneous datasets

    • Leveraging model organism data harmonization frameworks like the Alliance of Genome Resources

These technologies, particularly when used in combination, offer powerful approaches to move C1orf43 homolog from "uncharacterized" status to a protein with defined biological functions and mechanisms.

How can researchers contribute to the collaborative understanding of C1orf43 homolog?

Advancing knowledge about uncharacterized proteins like C1orf43 homolog benefits from collaborative approaches and data sharing:

  • Data standardization and submission:

    • Submit experimental data to appropriate repositories following FAIR principles

    • Utilize controlled vocabularies and ontologies to enhance data interoperability

    • Contribute to the Alliance of Genome Resources database which harmonizes data across model organisms

  • Cross-disciplinary collaboration strategies:

    • Form consortia bridging structural biology, systems biology, and functional genomics

    • Implement consistent experimental protocols across research groups

    • Conduct parallel studies across multiple model organisms to leverage comparative approaches

  • Technology sharing and standardization:

    • Develop and share optimized protocols for C1orf43 homolog expression and purification

    • Establish repositories for validated reagents (antibodies, expression constructs)

    • Create benchmark datasets for computational method development

  • Community-driven annotation:

    • Contribute to functional annotation of C1orf43 homolog in databases

    • Participate in gene ontology curation efforts

    • Support harmonization of cross-organism data through expert annotation

By leveraging these collaborative approaches and the integrated data frameworks being developed by resources like the Alliance of Genome Resources, researchers can accelerate the transition of C1orf43 homolog from an uncharacterized protein to one with well-defined functions and biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.