Recombinant Mouse Uncharacterized protein C2orf74 homolog

What is the C2orf74 protein and its mouse homolog?

C2orf74 is a protein encoding gene located on the short arm of chromosome 2 at position 2p15 in humans. The mouse homolog of this protein shares significant sequence similarity with the human version. The human gene spans 19,713 base pairs and includes 8 exons . The mouse homolog maintains the core structural and functional characteristics, making it a valuable model for studying the protein's function in mammalian systems. The full amino acid sequence of the mouse homolog reveals potential membrane-spanning regions and putative functional domains that may be critical for its biological activity .

What are the molecular characteristics of the mouse C2orf74 homolog?

The recombinant mouse C2orf74 homolog is a 196 amino acid protein with the following sequence: MFTQSDTGKIEEIFTTNTMAFETTAITFFFILLICFICILLLLAIFLYKCYRGHNHEEPL KTLCTGEGCVAANAEMDKPEDQDKVLMHFLNMGLPMKPSILVQKQSKEEMATSLGDNIKA EDYQKKQTYEPVNARETNHEGELAEKMPIHVHRSSDTGSQKRPLKGVTFSKEVIVVDLGN EYPTPRSYAREHKERK . Sequence analysis suggests the presence of a transmembrane domain (residues approximately 25-45) indicated by the hydrophobic stretch "TFFFILLICFICILLLLAIFLYKCYR," which is characteristic of membrane-associated proteins. The protein has a UniProt ID of Q810S2 . Its molecular weight is approximately 22 kDa, which can be confirmed through SDS-PAGE analysis.

How many isoforms of C2orf74 exist and how do they differ?

Based on analysis of human C2orf74, there are two main isoforms resulting from alternative splicing, with isoform 1 being 187 amino acids in length. Six validated mRNA transcript variants have been identified, with transcript variant 1 encoding isoform 1 (187 aa) and the remaining variants (transcripts 2-6) encoding isoform 2 (115 aa) . The mouse homolog shares this pattern of alternative splicing. The difference between isoforms primarily affects the N-terminal region, which may influence subcellular localization and/or binding partners. There is also a putative extended version of isoform 1 that utilizes an upstream start codon, potentially resulting in a 194 aa protein .

What are the optimal storage conditions for recombinant C2orf74 homolog?

The recombinant mouse C2orf74 homolog should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . For short-term storage (up to one week), working aliquots can be kept at 4°C . The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For long-term storage, it is recommended to add glycerol to a final concentration of 50% before storing at -20°C/-80°C . This storage protocol maintains protein stability and prevents degradation that can result from repeated freezing and thawing.

What is the recommended reconstitution protocol for lyophilized C2orf74 homolog?

For reconstitution of lyophilized recombinant mouse C2orf74 homolog, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 5-50% is recommended for stability during storage, with 50% being the standard concentration used by manufacturers . After reconstitution, the solution should be gently mixed and allowed to sit at room temperature for 10-15 minutes before aliquoting for storage to ensure complete solubilization.

How should researchers validate the purity and identity of recombinant C2orf74 homolog?

To validate the purity and identity of recombinant mouse C2orf74 homolog, researchers should perform SDS-PAGE analysis, which should show a single major band at approximately 22 kDa with greater than 90% purity . Western blotting using antibodies against the His-tag or specifically against C2orf74 can confirm the identity of the protein. Mass spectrometry analysis can provide definitive confirmation of the protein's identity by matching peptide fragments to the expected sequence. For functional validation, researchers might need to develop specific assays based on the hypothesized function of the protein, potentially including protein-protein interaction studies or cellular localization experiments.

What experimental approaches should be used to investigate C2orf74 homolog function?

Given the uncharacterized nature of C2orf74 homolog, multiple complementary approaches should be employed to elucidate its function:

• Subcellular localization studies: Using GFP-tagged constructs or immunofluorescence with anti-C2orf74 antibodies to determine where the protein localizes within cells.

• Protein-protein interaction studies: Techniques such as yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling (BioID, APEX) to identify binding partners that may suggest functional pathways.

• Knockout/knockdown experiments: CRISPR-Cas9 genome editing or RNAi to deplete C2orf74 in cellular or animal models, followed by phenotypic analysis to understand the consequences of its absence.

• Overexpression studies: Examining the effects of increased C2orf74 levels on cellular processes and potential rescue experiments in knockout models.

• Structure-function analysis: Creating truncated or mutated versions of the protein to identify which domains are essential for its function.

These approaches should be conducted in relevant cell types, considering the potential roles of C2orf74 in autoimmune disorders and colon diseases .

How does the mouse C2orf74 homolog compare to human C2orf74 structurally and functionally?

The mouse C2orf74 homolog shares significant sequence homology with human C2orf74, though the exact percentage identity requires detailed sequence alignment analysis. Both proteins appear to have similar structural features, including potential transmembrane domains and conserved motifs. The human C2orf74, located on chromosome 2p15, has been linked to autoimmune disorders like ankylosing spondylitis and colon diseases . The mouse homolog is thought to serve as a reasonable model for studying the function of this protein, though species-specific differences should be considered when extrapolating findings between models. The fact that C2orf74 has orthologs in 135 different species, primarily placental mammals and some marsupials , suggests evolutionary conservation of function, implying its biological importance.

What is known about the potential role of C2orf74 in disease states?

Current research indicates that C2orf74 may play a role in autoimmune disorders such as ankylosing spondylitis and diseases affecting the colon . The mechanism by which C2orf74 contributes to these conditions remains unclear, but several hypotheses exist:

• Immune modulation: The protein might be involved in regulating immune responses, with dysregulation contributing to autoimmunity.

• Epithelial barrier function: Given its potential transmembrane nature, C2orf74 could play a role in maintaining epithelial barriers in the intestine, with dysfunction leading to increased permeability and inflammation.

• Signaling pathways: C2orf74 may participate in cellular signaling cascades relevant to inflammation or tissue homeostasis.

Research using the mouse homolog as a model system has the potential to elucidate these mechanisms, particularly through knockout studies and disease models of inflammatory bowel conditions or autoimmune disorders.

What strategies can be employed to identify potential binding partners of C2orf74 homolog?

To identify potential binding partners of the C2orf74 homolog, researchers should consider a multi-faceted approach:

• Affinity purification-mass spectrometry (AP-MS): Using the His-tagged recombinant protein as bait to pull down interacting proteins from cell lysates, followed by mass spectrometry identification.

• Proximity-dependent biotin identification (BioID or TurboID): Fusion of C2orf74 with a biotin ligase to biotinylate proteins in close proximity in living cells, allowing for the identification of the proximal proteome.

• Crosslinking-MS approaches: Chemical crosslinking of interacting proteins followed by MS analysis to identify direct binding partners.

• Yeast two-hybrid screening: A genetic approach to identify binary protein-protein interactions in a cellular context.

• Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): Biophysical techniques to validate and characterize direct interactions with candidate partners.

• Co-immunoprecipitation with specific antibodies: To validate interactions in native cellular environments.

Each method has strengths and limitations; therefore, confirmation of interactions using multiple approaches is recommended for robust findings.

How can researchers address the challenges of working with an uncharacterized protein?

Working with an uncharacterized protein like C2orf74 homolog presents unique challenges that require systematic approaches:

• Bioinformatic prediction: Utilizing sequence analysis tools to predict domains, motifs, and potential functions based on homology with known proteins or structural features.

• Comparative genomics: Examining conservation across species to identify functionally important regions and potential evolutionary insights.

• Structural characterization: Using techniques like X-ray crystallography, NMR, or cryo-EM to determine the protein's three-dimensional structure, which can provide functional clues.

• Expression profiling: Determining when and where the protein is expressed using techniques like qPCR, RNA-seq, and immunohistochemistry to understand its biological context.

• Phenotypic screens: Systematic evaluation of the effects of protein modulation (overexpression, knockdown, mutation) on cellular phenotypes.

• Functional genomics approaches: CRISPR screens or synthetic genetic array analysis to identify genetic interactions that may suggest functional pathways.

• Iterative hypothesis testing: Developing and testing multiple hypotheses about protein function based on preliminary data and gradually refining understanding.

This systematic approach allows researchers to progressively build knowledge about an uncharacterized protein's function and significance.

What expression systems are optimal for producing recombinant C2orf74 homolog for functional studies?

Several expression systems can be considered for producing recombinant C2orf74 homolog, each with specific advantages:

For functional studies, the choice of expression system should be guided by the specific research questions. If post-translational modifications are suspected to be important for function, mammalian or insect cell systems would be preferable despite lower yields. For structural studies requiring large protein quantities, bacterial expression might be more practical, provided the protein folds correctly.

What are the most promising approaches for determining the biological function of C2orf74 homolog?

To elucidate the biological function of the C2orf74 homolog, several integrated approaches show particular promise:

• Comprehensive phenotyping of knockout models: Generating C2orf74 knockout mice and characterizing phenotypes across multiple systems, with particular attention to immune function and intestinal homeostasis given the protein's potential role in autoimmune and colon diseases .

• Tissue-specific conditional knockouts: To overcome potential embryonic lethality and investigate tissue-specific functions.

• Single-cell transcriptomics and proteomics: To identify cellular pathways affected by C2orf74 modulation and clarify its role in specific cell populations.

• In vivo models of relevant diseases: Testing the impact of C2orf74 manipulation in mouse models of ankylosing spondylitis, inflammatory bowel disease, or other autoimmune conditions.

• High-resolution imaging: Using super-resolution microscopy and live cell imaging to track C2orf74 dynamics and localization during cellular processes.

• Systems biology approaches: Integrating multiple data types (genomics, transcriptomics, proteomics, metabolomics) to position C2orf74 within broader biological networks.

These approaches, used in combination, would provide complementary insights into the biological function of this uncharacterized protein.

How can contradictory data about C2orf74 homolog function be reconciled in research?

Contradictory data regarding C2orf74 homolog function may arise due to several factors that researchers should systematically address:

• Isoform-specific effects: The presence of multiple isoforms (two confirmed in humans) may lead to different or even opposing functions. Researchers should clearly specify which isoform is being studied and consider isoform-specific approaches.

• Context-dependent functions: C2orf74 may function differently depending on cell type, developmental stage, or physiological condition. Experimental context should be thoroughly documented and considered when interpreting results.

• Technical variations: Differences in protein tags, expression levels, or experimental systems can lead to contradictory results. Standardizing technical approaches and validating findings using multiple methodologies can help resolve such contradictions.

• Reproducibility assessment: Independent replication of key experiments by different research groups, preferably using distinct methodologies, is essential for resolving contradictions.

• Integrated data analysis: Meta-analysis of multiple datasets and integration of diverse experimental approaches can help identify consistent patterns amid seemingly contradictory results.

When contradictions persist, they often highlight complex biological realities rather than simple experimental errors and may actually provide valuable insights into multifaceted protein functions.

What specific methodological challenges must be addressed when studying the potential transmembrane regions of C2orf74 homolog?

The amino acid sequence of mouse C2orf74 homolog (MFTQSDTGKIEEIFTTNTMAFETTAITFFFILLICFICILLLLAIFLYKCYRGHNHEEPL...) suggests potential transmembrane domains, presenting specific methodological challenges:

• Protein solubility and purification: Transmembrane proteins are notoriously difficult to solubilize and purify in their native conformation. Specialized detergents or amphipols may be required to maintain proper folding.

• Structural determination: Traditional structural biology techniques like X-ray crystallography face challenges with transmembrane proteins. Cryo-EM or solid-state NMR might be more suitable alternatives.

• Functional reconstitution: To study function, the protein may need to be reconstituted into artificial membrane systems like liposomes or nanodiscs, requiring optimization of lipid composition.

• Topology determination: Experimental approaches such as protease protection assays, site-directed fluorescence labeling, or epitope insertion combined with antibody accessibility studies are needed to determine the orientation of the protein in the membrane.

• Post-translational modifications: If the protein undergoes modifications that affect its membrane association or orientation, expression systems that recreate these modifications are essential.

• Protein-lipid interactions: Specialized techniques like lipid overlay assays or lipidomics approaches may be needed to identify specific lipid interactions that could be functionally relevant.

Addressing these challenges requires specialized expertise and often collaboration between structural biologists, biochemists, and cell biologists for comprehensive characterization.