Recombinant Mouse Uncharacterized protein C3orf18 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order to ensure preferential development.
Synonyms
Uncharacterized protein C3orf18 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTSFNDTRIPDVAGGAAG VGTMLLSFGIITVIGLAVAMVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHG RDAASMQAAASLQVTQGKSTLPSQGPLQRPSRLVFTDVANAIHA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C3orf18 homolog and what is known about its structure in mice?

C3orf18 homolog is a single-pass membrane protein. Based on human C3orf18 data, the mouse homolog is predicted to be approximately 162 amino acids in length. It belongs to a class of proteins that have one transmembrane domain, with the gene mapping to a region homologous to human chromosome 3q25.3 . The mouse C3orf18 homolog shares structural similarities with its human counterpart but, as its name suggests, remains largely uncharacterized in terms of specific biological functions.

What expression systems are optimal for producing recombinant mouse C3orf18 homolog?

Several expression systems can be used for producing recombinant mouse C3orf18 homolog:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, short turnaround time May lack post-translational modifications
YeastHigher yields than mammalian systems, some post-translational modifications Different glycosylation patterns than mammalian cells
Insect cellsBetter post-translational modifications, proper protein folding Lower yield than bacterial systems
Mammalian cellsOptimal post-translational modifications, highest likelihood of proper folding and activity Lower yield, higher cost, longer production time

For basic structural studies, E. coli expression systems are commonly used, as evidenced by commercially available recombinant C3orf18 homolog proteins that are produced in E. coli .

What purification methods are most effective for recombinant mouse C3orf18 homolog?

For His-tagged recombinant mouse C3orf18 homolog (which is commonly available ), the following purification protocol is recommended:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

  • Optional intermediate purification using ion exchange chromatography

  • Size exclusion chromatography for final polishing

Typical purification yields proteins with greater than 90% purity as determined by SDS-PAGE, similar to other recombinant proteins like mouse uncharacterized protein C1orf185 homolog .

What are the optimal storage conditions for maintaining stability of recombinant mouse C3orf18 homolog?

Based on storage recommendations for similar recombinant proteins:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • For short-term storage, working aliquots can be stored at 4°C for up to one week

  • Reconstituted protein is typically stored in buffer containing a cryoprotectant such as glycerol (recommended at 5-50% final concentration)

Repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity.

What buffer compositions are recommended for reconstitution and storage?

Buffer PurposeRecommended Composition
Storage BufferTris/PBS-based buffer, pH 7.5-8.0, with 6% Trehalose
ReconstitutionDeionized sterile water to a concentration of 0.1-1.0 mg/mL
Working SolutionPBS with 5-50% glycerol (final concentration)

For membrane proteins like C3orf18 homolog, addition of mild detergents may help maintain solubility, though specific detergent recommendations for this protein are not established in the literature.

How can Hi-C and chromatin interaction analysis be applied to study genes like C3orf18 homolog?

Hi-C analysis can reveal long-range chromatin interactions that may regulate C3orf18 homolog expression. Based on studies of other chromosomal regions:

  • Hi-C data can show interactions between the C3orf18 locus and distant regulatory elements

  • These interactions may extend as far as 10Mb, as demonstrated in studies of chromosome 18 loci

  • Methodology involves:

    • Crosslinking chromatin with formaldehyde

    • Digestion with restriction enzymes

    • Proximity ligation

    • Deep sequencing

    • Computational analysis to identify interaction hotspots

When applying this to C3orf18 homolog research, investigators can identify potential enhancers or silencers that regulate its expression, even if they are located far from the gene itself .

What approaches can be used to determine the potential function of C3orf18 homolog?

Since C3orf18 homolog is uncharacterized, multiple complementary approaches are recommended:

  • Colocalization analysis:

    • Define a window spanning approximately 400Kb centered at key variants

    • Use packages like R's coloc for testing colocalization with known functional elements

    • Set threshold of H4 (posterior probability) > 0.7 as evidence for significant colocalization

  • Transcriptional analysis:

    • Leverage GTEx data to identify tissues with significant expression

    • Compare transcriptional changes in different tissues to identify potential functional pathways

    • Categorize expression data into high and low groups based on median expression levels

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify binding partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Pull-down assays with tagged recombinant protein

How can differential gene expression analysis be used to study C3orf18 homolog in various physiological contexts?

Differential gene expression analysis can provide insights into the regulation and potential function of C3orf18 homolog under various conditions:

  • Methodology overview:

    • Normalize gene expression data across samples

    • Categorize by expression level (high/low based on median)

    • Compare expression patterns between different physiological states

    • Identify co-regulated genes that might share functional pathways

  • Analysis approach:

    • For each condition (e.g., high-fat diet vs. control), contrast samples carrying different genotypes

    • Identify transcripts in the region associated with the genotype of interest

    • Generate enrichment pathway analysis using packages like clusterProfiler

    • Conduct overrepresentation analysis to identify biological functions

This approach has successfully identified metabolically relevant microproteins in adipocytes and could be adapted to study C3orf18 homolog in various tissues.

What controls should be included when studying uncharacterized proteins like C3orf18 homolog?

Control TypePurposeImplementation
Positive ControlValidate experimental systemUse well-characterized protein from the same family or with similar properties
Negative ControlEstablish background signalEmpty vector expression or irrelevant protein of similar size and properties
Expression ControlVerify protein expressionWestern blot with tag-specific antibody (e.g., anti-His for His-tagged proteins)
Activity ControlBenchmark purification qualityStandardized activity assay for similar proteins (if available)
Purity ControlAssess sample qualitySDS-PAGE analysis under reducing and non-reducing conditions

When publishing results, include detailed descriptions of controls and their rationale to enhance reproducibility.

How can researchers address challenges in studying proteins with unknown function?

When working with uncharacterized proteins like C3orf18 homolog, consider these methodological approaches:

  • Sequence-based prediction:

    • Leverage computational tools to identify conserved domains

    • Use PhyloCSF to evaluate coding potential (positive scores suggest functional coding regions)

    • Employ tBLASTn to find sequence similarity between species

  • Expression pattern analysis:

    • Examine tissue-specific expression patterns

    • Identify conditions that regulate expression

    • Look for co-expressed genes with known functions

  • Conservation analysis:

    • Identify conserved MPs across multiple mammalian species

    • Focus on highly conserved regions which often indicate functional importance

    • Apply a cross-species comparative approach to identify functionally important domains

  • Proximity labeling:

    • Use BioID or APEX2 fusion proteins to identify proteins in close proximity

    • Map the protein's microenvironment to infer function

How should ribosome profiling (Ribo-Seq) data be analyzed to characterize uncharacterized proteins?

Ribosome profiling can provide evidence for translation of uncharacterized proteins like C3orf18 homolog:

  • Data processing workflow:

    • Process raw sequencing data to identify ribosome-protected fragments

    • Map reads to reference genome

    • Use tools like RibORF to annotate potential coding regions

    • Look for three-nucleotide periodicity, which indicates active translation

  • Validation approaches:

    • Collect multiple biological replicates to improve confidence in annotations

    • Analyze amino acid frequency patterns compared to known proteins

    • Verify translation using mass spectrometry-based proteomics

  • Interpretation guidelines:

    • Consider that detection of translation doesn't automatically imply function

    • Examine conservation across species as indicator of functional importance

    • Look for tissue-specific expression patterns that might suggest function

What proteomics approaches are recommended for confirming expression of C3orf18 homolog?

Mass spectrometry-based proteomics approaches for validating expression include:

  • Data-Independent Acquisition (DIA-MS):

    • Allows quantification of low-abundance proteins without prior knowledge

    • Can detect and quantify microproteins in cell lysates and conditioned media

    • Enables comparison between different tissue types or conditions

  • Sample preparation considerations:

    • For membrane proteins like C3orf18 homolog, use detergent-based extraction

    • Consider protein enrichment methods (e.g., His-tag pulldown)

    • Include fractionation steps to improve detection of low-abundance proteins

  • Validation criteria:

    • Multiple unique peptides should be identified

    • Fragmentation patterns should match theoretical predictions

    • Consistent detection across biological replicates

When reporting proteomics data, include detailed methodology and statistical analysis to ensure reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.