Recombinant Mouse Uncharacterized protein C3orf33 homolog

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

The C3orf33 gene is located on chromosome 3 in humans (orthologous in mice) and encodes a protein with predicted roles in:

  • Negative regulation of ERK1/ERK2 cascade (mitogen-activated protein kinase pathways) .

  • Regulation of DNA-binding transcription factor activity, potentially modulating gene expression .

Research Applications and Functional Insights

While the protein’s exact biological role remains uncharacterized, studies suggest its involvement in:

Transcriptional Regulation

Isoform 2 of C3orf33 is secreted and may influence transcription via the MAPK3/MAPK1 pathway, interacting with unidentified plasma membrane receptors . This aligns with its potential role in modulating cellular responses to external signals.

Experimental Tools

  • Antibodies: Polyclonal antibodies (e.g., PA5-58047 from Thermo Fisher) target the immunogen sequence RLTSKFTSSSDIPVEFIRRNVKLRGRLRRI and show 83% cross-reactivity with mouse orthologs .

  • Recombinant Proteins: Used in binding assays, co-immunoprecipitation (co-IP), or pull-down experiments to study interactions with other proteins or DNA .

Orthologous Relationships

The protein exhibits sequence conservation across species, as outlined in Table 2.

SpeciesGeneChromosomeAA Sequence Identity
HumanC3orf333q22.3
MouseC3orf3383% (with human)
RatC3orf3381% (with human)

Functional Pathways and Interactions

Limited data exist on direct interactions, but inferred pathways include:

  1. ERK Signaling Suppression: Regulation of ERK1/ERK2 activity, which impacts cell proliferation and differentiation .

  2. Transcription Factor Modulation: Potential interaction with DNA-binding proteins to alter gene expression profiles .

Challenges and Future Directions

  • Functional Uncertainty: The protein’s role remains speculative due to limited experimental validation.

  • Research Gaps: Pathway-specific interactions (e.g., MAPK, transcription factors) require further elucidation.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
Protein C3orf33 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-294
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Protein Sequence
ARPPASLGSQAPDRDRGEANVVTRVSQWADNHLRLVQNISTGMAIAGIMLLIRSVRLTSK FTTSSDIPVEFIRKKVKLRGRLQRITECGLEIEHIPITLPFISSWKEEPRGVLLVKLAGV ELTESGKVWLQAELKPSQLLWFQLLGKEDSALFCYLLVNKGGYFNVNLNEEILRRGLGKT VLVKGLNYDSKTHWKIHRNLLKAELTALKKGEGIWKEESEKESYFRKLKDSWRERWTKDN DLKPAGADLGSTKDSYHDSRRRASGKGKDSVSNYSFFLKLREFVSRLHFWRKG
Uniprot No.

Target Background

Function
This protein may play a role in transcriptional regulation.
Database Links

KEGG: mmu:329659

UniGene: Mm.39342

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.