Recombinant Mouse Uncharacterized protein C3orf43 homolog

Shipped with Ice Packs
In Stock

Description

Background

C3orf43, also known as single-pass membrane protein with coiled-coil domains 1, was found to be significantly upregulated during the proliferative phase of liver regeneration, suggesting its vital role in liver cell proliferation . Although it has been identified as important, its physiological functions have remained largely unclear .

Research Methods

To study the function of C3orf43, various methods have been employed:

  • RT-qPCR and Western Blot: These methods are used to measure the expression levels of C3orf43 in cells that have been modified to either increase (overexpress) or decrease (knockdown) C3orf43 levels .

  • MTT Assay and Flow Cytometry: These are used to determine cell growth and proliferation rates .

  • Genetic manipulation: Introducing genes that control the expression of hM3Dq, a receptor, into cells to observe changes in cellular activity and behavior .

  • Recombinase-responsive mouse lines: These lines allow hM3Dq expression in virtually any cell type by using Cre or Flp recombinases to control gene expression .

Research Findings

Research has shown that C3orf43 is involved in cell proliferation. Key findings include:

  • Hepatocyte Proliferation: Upregulation of C3orf43 promotes hepatocyte proliferation, while inhibition of C3orf43 reduces cell proliferation .

  • Gene Expression Regulation: C3orf43 affects the expression of cell proliferation-related genes such as JUN, MYC, CCND1, and CCNA2 .

  • Liver Regeneration: C3orf43 is remarkably upregulated during liver regeneration, suggesting its involvement in this process .

    Time after partial hepatectomy (h)C3orf43 Content
    0Baseline
    12, 24, 30, 36, 72Remarkably Upregulated
    168Return to Baseline levels
  • Cell Cycle Progression: Overexpression of C3orf43 accelerates hepatocyte proliferation, while downregulation reduces hepatocyte proliferation .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Smco1; Single-pass membrane and coiled-coil domain-containing protein 1; Single-pass membrane protein with coiled-coil domains 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Smco1
Target Protein Sequence
DHNPDNKLRALDTQFKELDVTKDNLTLRFEHHSKTLASQAAQDEIWTAALALGFTSMELN IVYSYVIEVLICLHTRMLQKLPDLVRSLPTLASVLRRKAKNKHVRLVWESVLQEYGLQER DVSALCTFFIVHGNKGEHYAANVRRMYIKDVSFMITNMVKNQALQDGLLRAVQIIEKGKQ AQDPENSRAPLKELMPPVKD
Uniprot No.

Target Background

Database Links

KEGG: mmu:69576

UniGene: Mm.432545

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the mouse C3orf43 homolog protein and what are its basic structural features?

The mouse C3orf43 homolog protein, officially named single-pass membrane protein with coiled-coil domains 1 (SMCO1), is a protein that was found to be upregulated during liver regeneration. Its structural features include:

  • The mouse mRNA has a full length of 886 bp and encodes 214 amino acids

  • Contains a conserved domain called DUF4547 (typically spanning amino acids 144-206)

  • Shows high sequence homology with human and rat versions (91.27% amino acid sequence similarity)

  • Functions as a single-pass membrane protein with coiled-coil domains

  • The amino acid sequences of rat, mouse, and human homologs have similar structures and almost the same CDS length

How does recombinant mouse C3orf43 compare with its human counterpart?

Recombinant mouse C3orf43 shares significant homology with its human counterpart while maintaining species-specific characteristics:

  • 91.27% amino acid sequence similarity between mouse, rat, and human variants

  • All three homologous proteins share a conserved DUF4547 domain

  • Despite the high sequence similarity, functional studies should account for potential species-specific differences in protein-protein interactions

  • The high conservation across species suggests preserved evolutionary function, making mouse models potentially relevant for studying human applications

What expression systems are most effective for producing recombinant mouse C3orf43?

Based on similar recombinant mouse protein expression studies, the following systems have proven effective:

  • Bacterial expression (E. coli): Most commonly used for initial studies due to high yield and cost-effectiveness. BL21(DE3) strain is particularly suitable for recombinant mouse protein expression

  • Mammalian expression: For studies requiring proper post-translational modifications, CHO or HEK293T cells are recommended

  • Optimization considerations:

    • Temperature: Lower induction temperatures (16-20°C) often improve solubility

    • IPTG concentration: 0.1-1.0 mM, optimized for each construct

    • Culture media: Rich media such as TB or 2YT can improve yield

What purification strategies yield the highest purity of recombinant mouse C3orf43?

For optimal purification results:

  • Tag selection: His-tag fusion proteins allow for efficient purification using Ni-NTA affinity chromatography

  • Solubilization strategies:

    • For inclusion bodies: 8M urea or 6M guanidine HCl buffers followed by refolding

    • For soluble fraction: Native conditions with appropriate detergents if membrane-associated

  • Multi-step purification:

    • Initial capture: Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography to achieve >95% purity

  • Quality assessment: SDS-PAGE, Western blot, and SEC-MALS for molecular weight and oligomeric state determination

What cell-based assays are useful for characterizing the proliferative effects of recombinant mouse C3orf43?

Several validated methods for assessing C3orf43's effects on cell proliferation include:

  • Cell viability assays:

    • MTT assay: Used to measure cell metabolic activity as an indicator of cell viability and proliferation

    • Flow cytometry: For cell cycle analysis to determine percentages of cells in G1, S, and G2/M phases

  • Molecular analysis:

    • qRT-PCR: For measuring expression of proliferation-related genes (JUN, MYC, CCND1, CCNA2)

    • Western blot: To quantify protein expression levels of these markers

  • Experimental timeline:

    • Growth curve measurements at 24, 48, and 72 hours post-treatment

    • Cell cycle analysis after 48 hours of treatment with recombinant protein

How can researchers effectively measure C3orf43's impact on JUN, MYC, CCND1, and CCNA2 gene expression?

Based on published methodologies:

  • Experimental design:

    • Treatment groups: Control (vehicle), varying concentrations of recombinant C3orf43 (typically 1-100 ng/mL)

    • Time points: 12, 24, 48, and 72 hours post-treatment

  • qRT-PCR protocol:

    • RNA extraction: TRIzol reagent or column-based methods

    • cDNA synthesis: Use oligo(dT) primers for mRNA-specific reverse transcription

    • qPCR analysis: SYBR Green or TaqMan assays with appropriate reference genes (GAPDH, β-actin)

    • Data analysis: 2^(-ΔΔCT) method for relative quantification

  • Western blot verification:

    • Protein extraction: RIPA buffer with protease inhibitors

    • Protein loading: 20-50 μg per lane

    • Antibodies: Anti-JUN, anti-MYC, anti-CCND1, anti-CCNA2

    • Normalization: β-actin or GAPDH as loading controls

What are the key considerations for designing mouse studies to investigate C3orf43 function in liver regeneration?

Designing robust mouse studies requires careful planning:

  • Mouse strain selection:

    • Consider strain-specific differences in liver regeneration capacity

    • Use inbred strains to minimize genetic variability

    • Consider knockout/transgenic models for mechanistic studies

  • Model of liver regeneration:

    • Partial hepatectomy (PH): Gold standard model (typically 70% liver resection)

    • Chemical injury: CCl4 or acetaminophen for hepatotoxicity models

    • Control parameters: Age, sex, time of day for procedures

  • Experimental groups:

    • Minimum n=5-8 mice per group for adequate statistical power

    • Include appropriate controls (sham operation, vehicle treatment)

    • Randomization and blinding protocols to minimize bias

  • Timeline considerations:

    • Key time points for analysis: 0, 12, 24, 36, 48, 72, 120, and 168 hours post-PH

    • Endpoint measurements: Liver weight/body weight ratio, hepatocyte proliferation markers (Ki67, BrdU, PCNA)

  • Handling and environmental factors:

    • Minimize stress during handling to avoid confounding effects

    • Maintain consistent housing conditions (temperature, light/dark cycles)

    • Control for timing of procedures to account for circadian variations

How should researchers address potential artifacts in C3orf43 expression analysis caused by tissue dissociation?

Cell-type-specific transcriptional responses to tissue dissociation can create artifactual signatures:

  • Protocol optimization:

    • Use cold dissociation buffers to minimize transcriptional changes

    • Minimize processing time between tissue harvest and RNA extraction

    • Consider single-cell RNA-seq approaches to distinguish cell-type-specific responses

  • Validation strategies:

    • Compare results from multiple dissociation methods

    • Include time-matched controls for each processing step

    • Use in situ hybridization or immunohistochemistry as complementary approaches

    • Apply computational correction methods to account for dissociation-induced gene expression changes

What are the methodological approaches to study C3orf43's potential role in liver disease therapies?

To investigate C3orf43's therapeutic potential:

  • Loss and gain of function studies:

    • siRNA knockdown experiments: Using validated siRNAs targeting C3orf43 (e.g., siR1: GCTCCAAGCTCTAGACACA)

    • Overexpression studies: Using lentiviral vectors like pCDH-CMV-MCS-EF1-copGFP

    • CRISPR/Cas9 gene editing for stable knockout or knock-in models

  • In vivo administration of recombinant protein:

    • Protein formulation: Reconstitute lyophilized protein in sterile PBS

    • Delivery methods: Direct intrahepatic injection, intravenous administration, or nanoparticle-mediated delivery

    • Dosing regimen: Pilot studies to determine effective dose range and schedule

  • Liver disease models suitable for testing:

    • Acute liver failure models: Acetaminophen overdose, CCl4, or α-amanitin

    • Chronic liver injury: Bile duct ligation, chronic CCl4, or thioacetamide

    • Fatty liver disease: High-fat diet or methionine-choline deficient diet

  • Outcome measures:

    • Liver function tests: ALT, AST, bilirubin, albumin

    • Histopathological assessment: H&E, Sirius red, immunohistochemistry

    • Molecular markers of regeneration: Ki67, PCNA, cyclins

    • Long-term outcomes: Survival, liver fibrosis progression/regression

How can researchers design experiments to elucidate the signaling pathways regulated by C3orf43?

For comprehensive pathway analysis:

  • Phosphoproteomic approaches:

    • Stimulate cells with recombinant C3orf43 at multiple time points (5, 15, 30, 60 min)

    • Enrich for phosphopeptides using TiO2 or IMAC

    • Analyze by LC-MS/MS to identify phosphorylation changes

    • Validate key findings by Western blot with phospho-specific antibodies

  • Transcriptomic analysis:

    • RNA-seq of cells treated with recombinant C3orf43

    • Time course experiments (6, 12, 24, 48h) to capture early and late responses

    • Pathway enrichment analysis using tools like GSEA, IPA, or Metascape

    • Validation of key targets by qRT-PCR

  • Interactome mapping:

    • Immunoprecipitation followed by mass spectrometry (IP-MS)

    • Proximity labeling approaches (BioID or APEX)

    • Yeast two-hybrid screening

    • Co-immunoprecipitation validation of key interactions

  • Pharmacological inhibitor studies:

    • Target specific pathways identified in -omic studies

    • Measure effect on C3orf43-induced proliferation and gene expression

    • Include dose-response experiments and appropriate controls

What strategies can improve the solubility and stability of recombinant mouse C3orf43?

Enhancing protein solubility and stability:

  • Expression optimization:

    • Lower induction temperature (16-20°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use solubility-enhancing fusion tags (MBP, SUMO, Trx)

  • Buffer optimization:

    • Screen different pH values (typically 6.5-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Include stabilizing additives:

      • Glycerol (5-10%)

      • Arginine (50-100 mM)

      • Non-ionic detergents (0.05-0.1% Triton X-100 or NP-40)

  • Refolding strategies for inclusion bodies:

    • Solubilization in 8M urea or 6M guanidine HCl

    • Dialysis-based refolding with step-wise reduction in denaturant concentration

    • Dilution method with optimized refolding buffer

    • On-column refolding during affinity purification

  • Storage considerations:

    • Add carrier protein (0.1% BSA) to prevent adsorption losses

    • Aliquot to avoid freeze-thaw cycles

    • Flash-freeze in liquid nitrogen

    • Store at -80°C for long-term stability

How can researchers address issues with specificity when studying the functions of C3orf43 in complex biological systems?

Ensuring experimental specificity:

  • Antibody validation:

    • Test antibody specificity using knockout controls

    • Perform peptide competition assays

    • Verify recognition of recombinant protein by Western blot

    • Consider raising custom antibodies if commercial options are inadequate

  • Genetic approaches for specificity:

    • Use multiple non-overlapping siRNAs to confirm phenotypes (e.g., siR1, siR2, siR3)

    • Include rescue experiments with siRNA-resistant constructs

    • Generate CRISPR/Cas9 knockout cell lines as definitive controls

  • Appropriate controls for recombinant protein experiments:

    • Heat-denatured protein

    • Unrelated protein purified under identical conditions

    • Stepped concentration ranges to establish dose-response

    • Endotoxin testing and removal to prevent confounding immune responses

  • Cell-type specificity considerations:

    • Use multiple cell types to determine specificity of response

    • Consider cell-type-specific knockout models

    • Apply single-cell analysis methods for heterogeneous tissues

    • Account for cellular composition changes in tissue samples

What are the expected proliferative effects and optimal dosages of recombinant mouse C3orf43 in hepatocyte models?

Based on experimental data:

ParameterObserved RangeOptimal ConditionsDetection Method
Proliferation increase1.5-2.5 fold48-72h post-treatmentMTT assay
S-phase cells15-25% increase48h post-treatmentFlow cytometry
Effective concentrationNot directly reported for recombinant proteinSimilar recombinant proteins: 1-100 ng/mLVarious assays
Gene expression fold-change (JUN, MYC)1.5-3.0 fold24-48h post-treatmentqRT-PCR
Protein expression increase1.2-2.0 fold48-72h post-treatmentWestern blot

What are the key molecular characteristics of mouse C3orf43 that researchers should reference?

Essential molecular parameters:

PropertyValueMethod of Determination
mRNA length886 bpSequencing
Protein length214 amino acidsSequence analysis
Molecular weight~24 kDa (theoretical)Sequence analysis
Conserved domainsDUF4547 (amino acids 144-206)Domain analysis
Species homology91.27% (rat, mouse, human)Sequence alignment
Subcellular localizationSingle-pass membrane proteinSequence prediction & localization studies
Gene expression in liver regenerationUpregulated 12-72h post-hepatectomy2D/MS and Western blot

What are promising approaches to elucidate the three-dimensional structure of C3orf43?

Advanced structural biology techniques to consider:

  • X-ray crystallography:

    • Construct optimization: Generate truncation variants to identify stable constructs

    • Surface entropy reduction: Mutate surface residues to enhance crystal contacts

    • Crystallization screening: Use high-throughput approaches with commercial screens

    • Data collection and processing: Synchrotron radiation for high-resolution datasets

  • Cryo-electron microscopy:

    • Sample preparation: Optimize protein concentration and grid conditions

    • Single-particle analysis: Collection of thousands of particle images

    • Computational reconstruction: Generate 3D structures from 2D projections

    • Resolution enhancement: Apply classification and refinement strategies

  • Nuclear magnetic resonance (NMR):

    • Isotopic labeling: Express protein with 15N, 13C, and/or 2H

    • Spectral assignment: Determine chemical shifts for backbone and side chains

    • NOE measurements: Establish distance constraints for structure calculation

    • Dynamics analysis: Characterize protein flexibility and domain movements

  • Computational approaches:

    • Homology modeling: Use related proteins as templates

    • Ab initio modeling: For domains lacking homologous structures

    • Molecular dynamics simulations: Study conformational changes

    • Integrative modeling: Combine experimental data from multiple sources

How might C3orf43 interact with other proteins in cellular signaling networks related to liver regeneration?

To explore protein interaction networks:

  • Candidate protein interaction studies:

    • Based on current knowledge of liver regeneration pathways, investigate interactions with:

      • Cyclins and cyclin-dependent kinases

      • Growth factor receptors (EGFR, HGFR)

      • JAK/STAT signaling components

      • PI3K/AKT pathway proteins

      • MAPK/ERK pathway members

  • Unbiased interactome mapping:

    • Affinity purification-mass spectrometry (AP-MS)

    • Proximity labeling (BioID, APEX)

    • Yeast two-hybrid screening

    • Protein microarray approaches

  • Validation and characterization strategies:

    • Co-immunoprecipitation in relevant cell types

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Mammalian two-hybrid assays

  • Network analysis:

    • Integration with existing protein-protein interaction databases

    • Pathway enrichment analysis

    • Network visualization tools (Cytoscape, STRING)

    • Mathematical modeling of signaling dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.