Recombinant Mouse Uncharacterized protein C4orf3 homolog
Description
Gene Overview
The C4orf3 gene in mice encodes a protein with a predicted role in calcium ion regulation. While the full-length human homolog (ARLN) spans 199 amino acids, the recombinant mouse version is a shorter isoform (1–65 aa) focused on conserved functional domains .
Key Attributes
Production Process
The protein is expressed in E. coli with an N-terminal His tag, followed by purification via nickel affinity chromatography. Key specifications include:
| Parameter | Value |
|---|---|
| Purity | >90% (SDS-PAGE validation) |
| Form | Lyophilized powder |
| Storage Buffer | Tris/PBS-based buffer with 6% trehalose, pH 8.0 |
| Reconstitution | 0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for storage |
| Storage | -20°C/-80°C; avoid freeze-thaw cycles |
Functional Applications
| Application | Use Case |
|---|---|
| Cell Culture | Studying ER calcium dynamics and SERCA regulation |
| In Vitro Studies | ELISA assays, protein-protein interaction mapping |
| Drug Discovery | Screening inhibitors of calcium homeostasis pathways |
Role in Calcium Regulation
The full-length C4orf3 homolog (ARLN) interacts with SERCA to modulate calcium uptake in the endoplasmic reticulum . While the recombinant mouse isoform lacks the transmembrane domain, it may retain partial functionality for studying:
-
SERCA inhibition: Binding to the inhibitory groove of SERCA.
-
Hepatitis C Virus (HCV) Pathogenesis: The human homolog is transactivated by HCV F protein (HCVFTP1) .
Comparative Analysis with Rat Homolog
| Feature | Mouse (Q99M08) | Rat (Q498U0) |
|---|---|---|
| Sequence Length | 65 aa | 65 aa |
| AA Sequence | MEVSQAASGTDGVRERRGSFEAGRRNQDEAPQSGMNGLPKHSYWLDLWLFILFDLALFVF VYLLP | MEVGQAASGTDGVRERRGSSAARRRSQDEPVQSGMNGIPKHSYWLDLWLFILFDLALFIF VYLLP |
| Expression System | E. coli | E. coli |
| Purity | >90% | >90% |
Experimental Uses
-
Calcium Homeostasis Studies:
-
Investigating SERCA activity modulation in neuronal or liver cells.
-
Assessing interactions with calcium-binding proteins (e.g., calmodulin).
-
-
Viral Pathogenesis:
-
Modeling HCV infection mechanisms using the recombinant protein.
-
-
Structural Biology:
-
Crystallization for 3D structure determination of the N-terminal domain.
-
Limitations
-
Functional Truncation: The recombinant isoform lacks the C-terminal transmembrane domain, limiting membrane localization studies.
-
Species-Specific Effects: Mouse and human homologs may differ in SERCA binding efficiency.
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
