Recombinant Mouse Uncharacterized protein C4orf34 homolog

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Uncharacterized Protein C4orf34 Homolog

Recombinant Mouse Uncharacterized Protein C4orf34 Homolog is a synthetic version of the murine homolog of human chromosome 4 open reading frame 34 (C4orf34). This protein is classified as an endoplasmic reticulum (ER)-resident, type I transmembrane protein with a single transmembrane domain (TMD). While its precise biological function remains uncharacterized, structural and localization studies suggest roles in ER-associated processes, including calcium homeostasis and stress response .

Amino Acid Sequence and Domains

The protein spans 99 amino acids (10.7 kDa) with a conserved sequence across species (e.g., 89.7% similarity to mouse and 69.7% to zebrafish) . Key features include:

  • N-Terminus: Luminal orientation within the ER, confirmed via engineered N-glycosylation sites (e.g., hC4orf34(NGly,N)) .

  • C-Terminus: Cytoplasmic localization containing proline-rich motifs (PXXP sequences), which may mediate protein-protein interactions .

  • Transmembrane Domain (TMD): Critical for ER retention, with length and composition determining localization rather than specific sequences .

Sequence Example:
MAEGGFDPCE CVCSHEHAMR RLINLLRQSQ SYCTDTECLR ELPGPSSDSG ISITVILMAW MVIAMLLFLL RPPNLRGSSL PGKPSSPHSG QDPPAPPVD

Production and Purity

Recombinant Mouse C4orf34 Homolog is expressed via cell-free systems, yielding ≥85% purity as determined by SDS-PAGE . Human homologs are often expressed in HEK293T cells with C-Myc/DDK tags , but the mouse version lacks such modifications .

ParameterValueSource
Molecular Weight10,732 Da (10.7 kDa)
Expression SystemCell-free
Purity≥85% (SDS-PAGE)
Storage BufferTris-based with 50% glycerol

Cellular Localization and Topology

C4orf34 homologs localize to the ER as type I transmembrane proteins:

  • Luminal N-Terminus: Confirmed via N-glycosylation of engineered sites .

  • Cytoplasmic C-Terminus: Proline-rich regions suggest potential interactions with SH3-domain proteins .

  • ER Retention: Mediated by TMD properties rather than specific motifs (e.g., K(X)KXX or RRXX) .

Proposed ER-Associated Roles

  • Calcium Homeostasis: ER-resident proteins often regulate Ca²⁺ levels, critical for cellular signaling .

  • ER Stress Response: While C4orf34 expression remains unchanged during ER stress, its structural features imply indirect roles in stress adaptation .

Experimental Applications

  • Protein-Protein Interaction Studies: Proline-rich C-terminus may recruit cytoplasmic adaptors (e.g., SH3-containing proteins) .

  • ER Dynamics Research: Useful for studying transmembrane protein trafficking and retention mechanisms .

Challenges and Future Directions

Despite structural characterization, the functional role of C4orf34 remains unclear. Key research gaps include:

  1. Interaction Partners: Identification of SH3-domain proteins binding to the C-terminal proline motifs.

  2. ER Stress Modulation: Direct evidence linking C4orf34 to calcium signaling or stress pathways.

  3. TMD Mechanism: Elucidating how TMD length/composition drives ER retention.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Smim14; Small integral membrane protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Smim14
Target Protein Sequence
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLRELPGPSSDSGISITVILMAW MVIAMLLFLLRPPNLRGSSLPGKPSSPHSGQDPPAPPVD
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is the basic structure and cellular localization of C4orf34/SMIM14?

C4orf34 (SMIM14) is a small integral membrane protein with 99 putative amino acids in humans and high conservation across species. It is an ER-resident type I transmembrane protein with a single transmembrane domain (TMD). The protein has its N-terminus in the ER lumen and its C-terminus in the cytoplasm, with the TMD being primarily responsible for its ER retention. The C-terminus contains a high proportion of proline residues (9 out of 29) with several proline-rich sequences (PXXP) that may mediate protein-protein interactions .

How conserved is C4orf34 between mouse and human models?

Sequence analysis reveals remarkable conservation of C4orf34 across species. The similarity of amino acid sequences between human C4orf34 and its homologs is 89.7% for mouse, 69.7% for zebrafish (Danio), and 70.7% for Xenopus. This high degree of conservation suggests functional importance across evolutionary lineages and supports the validity of mouse models for studying human C4orf34 function .

What is the expression pattern of C4orf34 in mouse tissues?

RT-PCR analysis using cDNA from various mouse tissues demonstrates that mouse C4orf34 (mC4orf34) is ubiquitously expressed across multiple organs. Significant expression has been detected in the heart, thymus, and hippocampus, along with other tissues. This widespread expression pattern suggests that C4orf34 may have fundamental cellular functions rather than tissue-specific roles .

What are the predicted molecular characteristics of the recombinant C4orf34 protein?

ParameterValue
Molecular Weight~10.5 kDa
Transmembrane Domains1
TopologyType I (N-terminus in lumen, C-terminus in cytoplasm)
Notable DomainsProline-rich C-terminal region (PXXP motifs)
Alternative NamesSMIM14, FLJ13289, hypothetical protein LOC201895

This information is critical for experimental design and antibody selection when working with the recombinant protein .

What experimental approaches can determine the topology of recombinant C4orf34 in cellular membranes?

To determine C4orf34 membrane topology, researchers should consider multiple complementary approaches:

  • N-glycosylation site insertion and analysis: Create mutants with artificial N-glycosylation sites (NX(S/T) where X≠P) in putative luminal regions. The presence of glycosylation (detected as mobility shifts on SDS-PAGE that disappear with tunicamycin treatment) indicates luminal localization.

  • Protease protection assays: Isolate microsomes containing the expressed protein and treat with proteases with/without membrane permeabilization. Domains protected from proteolysis without permeabilization are likely luminal.

  • Fluorescent protein fusion experiments: Create constructs with GFP/RFP fused to different termini and analyze colocalization with known ER markers like calnexin or Sec61.

For the mouse C4orf34 homolog, research has confirmed type I topology (N-terminus in ER lumen, C-terminus cytoplasmic) through N-glycosylation experiments similar to those used for human C4orf34 .

How can researchers effectively study C4orf34's potential role in ER stress responses?

To investigate C4orf34's involvement in ER stress:

  • Expression analysis: Monitor C4orf34 expression levels during ER stress induced by tunicamycin, thapsigargin, or DTT using qRT-PCR and Western blotting.

  • Knockout/knockdown studies: Use CRISPR-Cas9 or siRNA to reduce C4orf34 expression, then assess changes in ER stress markers (BiP/GRP78, CHOP, XBP1 splicing) under normal and stressed conditions.

  • Calcium imaging: Since C4orf34 may influence Ca²⁺ homeostasis, perform real-time calcium imaging using fluorescent indicators (Fura-2, Fluo-4) in cells with altered C4orf34 expression.

  • Protein-protein interaction studies: Identify binding partners through co-immunoprecipitation followed by mass spectrometry, focusing on the proline-rich C-terminal domain that may mediate interactions with SH3 domain-containing proteins .

What expression systems are most suitable for producing recombinant mouse C4orf34 protein?

For optimal recombinant expression of mouse C4orf34:

  • Mammalian expression systems (HEK293T, CHO cells) are strongly recommended for proper folding and post-translational modifications. HEK293T cells have been successfully used for human C4orf34 expression with high yield and proper localization.

  • For structural studies requiring higher yields, insect cell systems (Sf9, Hi5) with baculovirus may be appropriate, though careful validation of proper folding is necessary.

  • Bacterial systems are not recommended for full-length protein due to the transmembrane domain, which often causes aggregation and improper folding.

  • Important considerations include adding appropriate purification tags (His, FLAG, or C-Myc/DDK) that don't interfere with protein folding or function. The C-terminal tag is preferred given the protein's type I topology .

How might the conserved transmembrane domain of C4orf34 contribute to its ER retention mechanism?

The transmembrane domain (TMD) of C4orf34 plays a critical role in ER retention, as demonstrated through deletion mutant analysis. Advanced investigations should focus on:

  • Specific residue contributions: Perform alanine-scanning mutagenesis of the TMD to identify specific amino acids critical for ER retention.

  • Chimeric protein studies: Replace the C4orf34 TMD with TMDs from other proteins that traffic to different compartments to determine the specificity of the retention signal.

  • Interaction analysis: Investigate whether the TMD interacts with ER retention machinery such as the Rer1 protein or KDEL receptors using bimolecular fluorescence complementation or FRET approaches.

  • Structural analysis: Use NMR spectroscopy of the isolated TMD in membrane mimetics to determine structural features that may contribute to retention.

These approaches could reveal whether the ER retention mechanism involves direct recognition of TMD sequence elements or structural features that prevent export from the ER .

What experimental approaches can resolve contradictory data regarding C4orf34's role in calcium homeostasis?

To address conflicting findings about C4orf34's role in calcium homeostasis:

  • Temporal resolution studies: Use real-time calcium imaging with high temporal resolution in both C4orf34 knockout and overexpression systems to capture both immediate and sustained calcium responses.

  • Compartment-specific calcium measurement: Employ genetically encoded calcium indicators targeted to specific subcellular compartments (ER, mitochondria, cytosol) to determine where calcium dynamics are most affected.

  • Reconstitution experiments: In C4orf34 knockout cells, introduce wild-type or mutant variants to determine which domains are necessary for calcium regulation.

  • Direct interaction studies: Investigate potential interactions between C4orf34 and known calcium-regulating proteins (IP3 receptors, SERCA pumps, STIM proteins) using proximity labeling techniques like BioID or APEX.

  • Electrophysiological approaches: Patch-clamp techniques to measure store-operated calcium entry (SOCE) in cells with manipulated C4orf34 expression could resolve contradictions about its role in calcium influx .

How can researchers distinguish between direct and indirect effects of C4orf34 on ER stress pathways?

Differentiating direct from indirect effects requires sophisticated experimental design:

  • Temporal analysis: Create an inducible expression system for C4orf34 and monitor the sequence of molecular events following induction, with special attention to the chronological order of changes in ER stress markers.

  • Proximity-dependent biotinylation: Use BioID or APEX2 fused to C4orf34 to identify proteins in close proximity during normal conditions versus ER stress.

  • Rescue experiments with domain-specific mutants: Create a series of C4orf34 mutants affecting specific domains and determine which can rescue phenotypes in knockout cells.

  • Direct binding assays: Use surface plasmon resonance or microscale thermophoresis to test direct binding between purified C4orf34 and candidate interacting proteins in the ER stress pathways.

  • Single-cell analysis: Employ single-cell RNA-seq or proteomics on cells with varying C4orf34 expression levels to identify heterogeneous responses that may reveal direct versus secondary effects .

What are the common challenges in detecting endogenous C4orf34 protein expression and how can they be overcome?

Detecting endogenous C4orf34 presents several challenges:

  • Low abundance: The protein may be expressed at low levels, making detection difficult. Solution: Use enrichment techniques such as subcellular fractionation to isolate ER membranes before Western blotting, or employ signal amplification in immunostaining.

  • Antibody specificity: Commercial antibodies may lack specificity. Solution: Validate antibodies using positive controls (overexpressed protein) and negative controls (CRISPR knockout cells), and consider raising custom antibodies against unique epitopes.

  • Small protein size: At approximately 10.5 kDa, C4orf34 may be difficult to resolve on standard gels. Solution: Use specialized high-percentage (15-20%) or gradient gels optimized for small proteins, and consider tricine-SDS-PAGE systems.

  • Membrane protein extraction: Transmembrane proteins require special extraction conditions. Solution: Use appropriate detergents (CHAPS, DDM, or Triton X-100) and avoid harsh extraction conditions that may denature the protein .

What methodological approaches can address difficulties in purifying functional recombinant C4orf34?

Purification of functional C4orf34 requires careful consideration of its membrane protein characteristics:

  • Solubilization strategy: Test multiple detergents (DDM, CHAPS, digitonin) at various concentrations to identify optimal conditions that maintain protein structure. Perform functional assays after each solubilization to ensure activity is preserved.

  • Affinity tag position: Given C4orf34's type I topology, place purification tags at the C-terminus (cytoplasmic) to minimize interference with folding and function. C-Myc/DDK tags have been successfully used for human recombinant C4orf34.

  • Buffer optimization: Include glycerol (10%) and appropriate salt concentrations to stabilize the protein during purification. The formulation of 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol has proven effective for human C4orf34.

  • Quality control: Implement rigorous quality control using size-exclusion chromatography and dynamic light scattering to confirm monodispersity and absence of aggregation. Aim for purity >80% as determined by SDS-PAGE and Coomassie blue staining.

  • Storage conditions: Store purified protein at -80°C and avoid repeated freeze-thaw cycles that can compromise activity. Aliquot protein in single-use volumes to prevent degradation .

How can researchers resolve technical issues when studying protein-protein interactions involving C4orf34?

When investigating interactions of C4orf34 with other proteins:

  • Cross-linking optimization: For transient interactions, optimize chemical cross-linking conditions using graduated concentrations and exposure times. DSP (dithiobis(succinimidyl propionate)) is effective for membrane protein complexes due to its membrane permeability and reversibility.

  • Detergent selection: Test multiple detergents to find the optimal balance between complex preservation and solubilization. Digitonin (0.5-1%) or CHAPS (0.3-0.5%) often preserve interactions better than stronger detergents like SDS.

  • Control for transmembrane domain-mediated non-specific interactions: Include appropriate controls such as an unrelated transmembrane protein with similar topology to distinguish specific from non-specific interactions.

  • Consider the proline-rich domain: The C-terminal proline-rich region of C4orf34 may interact with SH3 domain-containing proteins. When designing constructs for interaction studies, preserve this domain and consider using it as bait in targeted pull-down experiments.

  • Proximity-based approaches: For challenging interactions, employ proximity labeling techniques like BioID or APEX2, which can capture even transient or weak interactions in the native cellular environment .

What emerging technologies might advance our understanding of C4orf34's physiological roles?

Several cutting-edge approaches could significantly enhance C4orf34 research:

  • Cryo-electron microscopy: Structural determination of C4orf34 alone or in complex with interacting partners could reveal mechanical insights into its function. Recent advances in single-particle analysis of membrane proteins make this increasingly feasible.

  • Genome-wide CRISPR screens: Conducting synthetic lethality or synthetic rescue screens in C4orf34 knockout cells could identify unexpected functional relationships and pathways.

  • Tissue-specific conditional knockout mouse models: Generate mice with tissue-specific C4orf34 deletion to understand its role in different physiological contexts, particularly in tissues with high expression like heart and brain.

  • Quantitative interactomics: Apply SILAC or TMT labeling combined with mass spectrometry to quantitatively compare the interactome of C4orf34 under normal versus stressed conditions.

  • Single-molecule imaging: Use techniques like single-particle tracking or super-resolution microscopy to observe C4orf34 dynamics and interactions in living cells with nanometer precision .

How might studies of C4orf34 contribute to understanding broader ER stress-related pathologies?

Given its potential role in ER functions and stress responses, C4orf34 research may have broader implications:

  • Neurodegenerative disease models: Investigate C4orf34 expression and function in models of diseases like Alzheimer's, Parkinson's, and ALS, where ER stress plays a known pathogenic role.

  • Cardiac pathophysiology: Given its expression in heart tissue, examine C4orf34's role in cardiac ER stress responses during ischemia-reperfusion injury or heart failure development.

  • Metabolic disorders: Explore how C4orf34 functions in pancreatic β-cells, where ER stress is linked to diabetes pathogenesis, potentially identifying new therapeutic targets.

  • Comparative studies in disease-resistant organisms: Examine C4orf34 function in organisms with exceptional stress resistance (like certain long-lived species) to identify potential protective mechanisms.

  • Drug discovery platforms: Develop high-throughput screens to identify compounds that modulate C4orf34 function as potential therapeutic agents for ER stress-related diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.