Recombinant Mouse Uncharacterized protein KIAA1467 (Kiaa1467)

Shipped with Ice Packs
In Stock

Description

Introduction to KIAA1467 Protein

KIAA1467 (Gene name: Kiaa1467) is classified as an uncharacterized protein, indicating that its complete biological functions remain to be fully elucidated through ongoing research. The mouse variant of this protein shares significant homology with the human KIAA1467 counterpart, suggesting potential evolutionary conservation of function across mammalian species . The protein derives its designation from the KIAA naming system, originally established by the Kazusa DNA Research Institute for novel human genes identified through their Human Unidentified Gene-Encoded (HUGE) large-scale cDNA sequencing project .

The mouse ortholog of KIAA1467, designated as mKIAA1467, has been documented by the Kazusa Mouse cDNA Project, establishing a parallel research track that enables comparative studies between human and mouse models . This cross-species approach potentially enhances our understanding of the protein's fundamental biological properties and evolutionary significance. The recombinant form of mouse KIAA1467 protein represents a valuable research tool, enabling controlled investigation of this protein in experimental settings.

Amino Acid Sequence and Protein Structure

The full-length recombinant mouse KIAA1467 protein encompasses 624 amino acids, presenting a comprehensive expression region for structural and functional analyses . The complete amino acid sequence has been determined and consists of the following primary structure:

MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQQKNGGVKNGKSALGDLPE
PDSDADVAGAAKPHLSEVTPEGFPSEPLGGLEQKATSPLVSYVRTSVFLLTLVISMVLVL
LCAFLIPCPPRDLHSAWSRRLGSQGGGDLSPLELADVNRDGLRDVLLTFVTTRNGTEGGV
GSQPTADLVCLSGMNGSTLWSSPLPEEAQDVTCLDLIPGSVAKVTCLVTGTRKLSAFNA
TSGKVLWTLNPNHLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGS
PVGRPVKYNIVGVGNLIGPQVYITASGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSL
QIEEPEWEKHRSVNLSELIDVYSDGVELLQLVKAPDSNSSSLLITTRQGLVLLRGQDLTP
HWKLNLQGLRSQPTPGYFTDDQTLDFLLQTQDGDGMKKMTVVDGGSGSIVWSYSIPCHMK
ETPTTSAITSDQKSVFLFWAEALTAASLSSDDSSGAEPPGLYHLYLLHPAFPSILLDLSN
TTGIVTASEVGINDIWKDAFYVTRTTGMSPEGHPTSLVVSKLSLRWALMEGQMVQLKETT
PKIGRGELRRFLSRIKFVDSPYQI

Analysis of this sequence reveals several notable characteristics. The protein includes multiple domains and motifs that suggest potential membrane association, as indicated by hydrophobic regions that could function as transmembrane segments. The presence of conserved sequences across species further suggests functional importance, though specific enzymatic or signaling activities remain to be characterized through targeted biochemical studies.

Genomic Organization

The mouse Kiaa1467 gene is located on chromosome 12 and comprises 10 exons, as determined through genomic mapping studies . This genomic organization potentially provides insights into the evolutionary history of the gene and its regulatory mechanisms. The gene structure shows significant conservation with its human counterpart, supporting the hypothesis of preserved biological function across mammalian lineages.

Recombinant Protein Production

The recombinant mouse KIAA1467 protein is produced through advanced molecular cloning and expression techniques, enabling the generation of purified protein for research applications . While the specific expression system is not explicitly detailed in the available sources, recombinant proteins of this nature are typically produced in prokaryotic (E. coli) or eukaryotic (insect or mammalian) cell systems depending on requirements for post-translational modifications and proper folding.

The commercially available recombinant protein is typically supplied with a molecular tag to facilitate purification and detection, though the specific tag type may vary and is determined during the production process . This approach ensures high purity and yield while maintaining the protein's structural integrity and potential functional activity.

Predicted Functional Domains

While the precise biological functions of KIAA1467 remain uncharacterized, computational analysis of its amino acid sequence suggests the presence of several conserved domains that may provide clues to its cellular roles. The sequence contains motifs consistent with:

  1. Potential membrane association, suggested by hydrophobic regions

  2. Possible protein-protein interaction domains

  3. Sequences that may participate in cellular signaling pathways

Further experimental validation is required to confirm these computational predictions and establish the protein's definitive functions in cellular contexts.

Research Applications

The recombinant mouse KIAA1467 protein serves as a valuable research tool in multiple experimental contexts:

  1. Generation of specific antibodies for immunological detection and localization studies

  2. Identification of binding partners through protein-protein interaction screening

  3. Functional assays to investigate potential enzymatic or signaling activities

  4. Structural studies using X-ray crystallography or cryo-electron microscopy

  5. Comparative analyses between mouse and human orthologs

These applications contribute to expanding our understanding of this uncharacterized protein and may ultimately reveal its significance in normal physiology and potential involvement in disease processes.

Knowledge Gaps

Despite the availability of recombinant KIAA1467 protein and sequence information, significant knowledge gaps remain regarding:

  1. Tissue-specific expression patterns and subcellular localization

  2. Developmental regulation and temporal expression dynamics

  3. Interaction networks and signaling pathway involvement

  4. Phenotypic consequences of gene deletion or overexpression

  5. Potential associations with disease states or physiological processes

These limitations highlight the need for comprehensive research approaches combining genomic, proteomic, and functional studies to fully characterize this protein.

Future Research Priorities

To advance understanding of KIAA1467, several research priorities emerge:

  1. Generation of knockout and conditional knockout mouse models to study phenotypic consequences

  2. Comprehensive protein interaction mapping using advanced proteomics techniques

  3. Structure determination through crystallography or cryo-EM approaches

  4. Tissue-specific expression profiling across developmental stages

  5. Investigation of potential roles in human diseases through translational research

Such multidisciplinary approaches would significantly expand the knowledge base regarding this uncharacterized protein and potentially reveal novel biological mechanisms or therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fam234b; Kiaa1467; Protein FAM234B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-624
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fam234b
Target Protein Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQQKNGGVKNGKSALGDLPE PDSDADVAGAAKPHLSEVTPEGFPSEPLGGLEQKATSPLVSYVRTSVFLLTLVISMVLVL LCAFLIPCPPRDLHSAWSRRLGSQGGGDLSPLELADVNRDGLRDVLLTFVTTRNGTEGGV GSQPTADLVCLSGMNGSTLWSSPLPEEAQDVTCLDLIPGSVAKTICLVTGTRKMLSAFNA TSGKVLWTLNPNHLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGS PVGRPVKYNIVGVGNLIGPQVYITASGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSL QIEEPEWEKHRSVNLSELIDVYSDGVELLQLVKAPDSNSSSLLITTRQGLVLLRGQDLTP HWKLNLQGLRSQPTPGYFTDDQTLDFLLQTQDGDGMKKMTVVDGGSGSIVWSYSIPCHMK ETPTTSAITSDQKSVFLFWAEALTAASLSSDDSSGAEPPGLYHLYLLHPAFPSILLDLSN TTGIVTASEVGINDIWKDAFYVTRTTGMSPEGHPTSLVVSKLSLRWALMEGQMVQLKETT PKIGRGELRRFLSRIKFVDSPYQI
Uniprot No.

Target Background

Database Links

KEGG: mmu:74525

UniGene: Mm.34182

Protein Families
FAM234 family
Subcellular Location
Membrane; Single-pass membrane protein. Golgi outpost. Cytoplasm, cytoskeleton, microtubule organizing center.

Q&A

What is mouse KIAA1467 protein and why is it of research interest?

Mouse KIAA1467 (also known as FAM234B) is an uncharacterized protein that shares structural homology with its human ortholog. The human version has an ORF size of 1866 bp, potentially indicating similar characteristics in the mouse variant . As an uncharacterized protein, it represents a frontier for discovery in molecular biology, with potential implications for understanding novel cellular pathways, protein-protein interactions, and possible roles in disease mechanisms. Research interest stems from elucidating its function, expression patterns, and potential involvement in developmental or pathological processes.

Which expression systems are most suitable for recombinant mouse KIAA1467 production?

Based on similar recombinant mouse protein studies, prokaryotic expression systems, particularly E. coli strains like BL21(DE3), offer efficient platforms for initial characterization work. For mouse KIAA1467, a prokaryotic system optimized with Terrific Broth (TB) culture medium can yield significant protein quantities under controlled induction conditions. Alternative systems include mammalian cell lines for proteins requiring post-translational modifications, yeast systems for moderate modifications, and baculovirus-insect cell systems for complex eukaryotic proteins . The choice depends on research objectives - prokaryotic systems work well for structural studies while mammalian systems may better preserve functionality for interaction studies.

What vector design considerations are important for optimal KIAA1467 expression?

When designing expression vectors for mouse KIAA1467, researchers should consider:

  • Promoter selection: Strong inducible promoters like T7 for prokaryotic systems or CMV for mammalian systems

  • Fusion tags: Addition of purification tags (His, GST, or MBP) that facilitate downstream purification while minimizing impact on protein folding

  • Inclusion of immunostimulatory sequences: For immunogenicity studies, incorporate peptides like tetanus toxin P2P30 and PADRE, which significantly enhance humoral immune responses as demonstrated in similar mouse protein studies

  • Codon optimization: Adjust codons to match expression host preferences

  • Cleavage sites: Include protease recognition sequences for tag removal

  • Regulatory elements: Incorporate appropriate enhancers, terminators, and selection markers

The vector backbone should be compatible with the target expression system, with appropriate resistance markers for selection.

What are the optimal conditions for expressing recombinant mouse KIAA1467 in E. coli?

For prokaryotic expression of mouse recombinant proteins similar to KIAA1467, optimal conditions include:

ParameterOptimal ConditionNotes
E. coli strainBL21(DE3)Deficient in lon and ompT proteases
Culture mediumTerrific Broth (TB)Superior to LB for protein yield
IPTG concentration0.25 mMHigher concentrations may not improve yield
Induction temperature15°CLower temperatures reduce inclusion body formation
Induction duration24 hoursExtended time increases yield for difficult proteins
Optical density at induction0.6-0.8 at 600nmMid-log phase offers balance of growth and expression

These parameters have been shown to significantly improve yield and solubility for recombinant mouse proteins in prokaryotic systems . Temperature is particularly critical - induction at 15°C rather than standard 37°C dramatically improves proper folding for many mammalian proteins expressed in bacterial systems.

What purification strategy yields the highest purity of recombinant mouse KIAA1467?

A multi-step purification strategy is recommended for maximum purity:

  • Initial extraction: For mouse recombinant proteins, buffers containing 2% sarkosyl have demonstrated superior yield and purity compared to standard lysis buffers

  • Affinity chromatography: Utilize the fusion tag (His, GST) for initial capture

  • Ion exchange chromatography: Based on the theoretical isoelectric point of KIAA1467

  • Size exclusion chromatography: For final polishing and buffer exchange

This approach typically yields >95% pure protein suitable for downstream applications including structural studies, antibody production, and functional assays. The inclusion of sarkosyl in extraction buffers is particularly effective for improving solubilization while maintaining native-like protein conformations.

How can protein solubility be enhanced during recombinant mouse KIAA1467 expression?

Enhancing solubility of recombinant mouse proteins requires multiple optimization strategies:

  • Temperature modulation: Lower induction temperatures (15°C) dramatically improve folding kinetics

  • Co-expression with chaperones: GroEL/ES, DnaK systems facilitate proper folding

  • Fusion partners: Solubility-enhancing tags like MBP, SUMO, or Thioredoxin

  • Solubilizing agents: 2% sarkosyl in extraction buffers improves solubilization while maintaining better structural integrity than traditional detergents like Triton X-100

  • Rare codon supplementation: Co-express rare tRNAs using plasmids like pRARE

  • Reduced induction strength: Lower IPTG concentrations (0.25 mM) for slower, more accurate folding

These approaches can be implemented individually or in combination, with systematic optimization for KIAA1467-specific requirements.

What techniques effectively confirm the identity and integrity of purified recombinant mouse KIAA1467?

Multiple complementary techniques should be employed for thorough validation:

  • Western Blotting: Using antibodies against the fusion tag or against KIAA1467 specifically

  • Mass Spectrometry: For accurate mass determination and sequence verification

  • ELISA: Confirming antigenicity and epitope preservation

  • Circular Dichroism: Evaluating secondary structure integrity

  • Dynamic Light Scattering: Assessing homogeneity and aggregation state

  • Functional Assays: Based on predicted functions or protein-protein interactions

Research on similar mouse recombinant proteins demonstrates that combining Western Blotting and ELISA provides reliable validation of protein identity and preservation of critical epitopes .

How can researchers assess the functional activity of recombinant mouse KIAA1467?

Since KIAA1467 is largely uncharacterized, functional assessment may require:

  • Binding assays with predicted interaction partners based on bioinformatic analysis

  • Cell-based assays examining effects on relevant signaling pathways

  • Comparative analysis with orthologs: Utilizing known information about human KIAA1467 (FAM234B)

  • Immunogenicity testing: If investigating as a potential antigen, evaluate humoral response generation in mouse models, comparing constructs with and without immunostimulatory peptides

  • Protein-protein interaction screening: Using techniques like pull-down assays or yeast two-hybrid systems to identify binding partners

  • Structural characterization: X-ray crystallography or NMR to inform function

The approach should combine hypothesis-driven experiments with unbiased screening methods to elucidate function.

How can recombinant mouse KIAA1467 be utilized in cancer research models?

For cancer research applications, recombinant KIAA1467 can be employed in several sophisticated approaches:

  • Expression profiling: Compare KIAA1467 expression across cancer and normal tissue using validated antibodies generated against the recombinant protein

  • Driver gene analysis: Assess whether KIAA1467 harbors mutations that confer selective advantage to cancer cells using methodology similar to that applied in driver gene prediction models

  • Protein-protein interaction mapping: Identify cancer-relevant binding partners using the purified recombinant protein as bait

  • Immunotherapy potential: Evaluate as a cancer-testis antigen candidate using the immunization protocol outlined for mouse placental proteins

  • miRNA regulation studies: Investigate whether KIAA1467 is regulated by miRNAs identified in breast cancer studies, applying target prediction databases like TargetScan, PicTar, and miRanda

These approaches leverage the purified recombinant protein to explore potential oncological relevance through multiple experimental paradigms.

What considerations are important when designing knockout or knockdown studies targeting mouse KIAA1467?

For genetic modification studies targeting KIAA1467:

  • Complete knockout vs. conditional systems: Consider temporal and tissue-specific regulation using Cre-Lox or tetracycline-inducible systems

  • Guide RNA design for CRISPR/Cas9: Target functionally critical domains predicted through bioinformatic analysis

  • Off-target effects: Perform thorough in silico prediction and experimental validation

  • Knockdown alternatives: Design shRNA or siRNA targeting multiple regions of KIAA1467 transcript

  • Phenotypic assessment strategy: Develop comprehensive panel of assays based on predicted functions

  • Rescue experiments: Use the validated recombinant protein to confirm specificity of observed phenotypes

  • Controls: Include appropriate wild-type and scrambled or non-targeting controls

The recombinant protein serves as a critical reagent for antibody validation and rescue experiments in these genetic studies.

What strategies address poor expression yield of recombinant mouse KIAA1467?

When encountering low expression yields:

  • Expression vector optimization: Re-evaluate promoter strength, codon optimization, and mRNA stability elements

  • Strain selection: Test multiple E. coli strains beyond BL21(DE3), such as Rosetta, Arctic Express, or Origami for proteins with disulfide bonds

  • Expression conditions: Systematically vary temperature (15-37°C), IPTG concentration (0.1-1 mM), and induction time (4-24 hours)

  • Media formulation: Compare TB, LB, 2xYT, and auto-induction media

  • Co-expression strategies: Include chaperones, rare tRNAs, or disulfide isomerases

  • Toxicity assessment: Evaluate growth curves to determine if the protein is toxic to host cells

A structured optimization approach examining these parameters individually and in combination typically resolves yield issues for challenging recombinant proteins.

How can researchers overcome solubility and aggregation issues with recombinant mouse KIAA1467?

For addressing solubility challenges:

ProblemSolution ApproachImplementation Details
Inclusion body formationRefolding protocolGradual dialysis with decreasing denaturant concentrations
Aggregation during purificationBuffer optimizationScreen additives: glycerol (5-10%), low concentrations of detergents, salt concentration variations
Poor solubility in aqueous buffersSolubilizing agents2% sarkosyl shows superior results compared to traditional detergents
Precipitation during concentrationStabilizing additivesArginine (50-200 mM), sucrose (5-10%), or specific amino acid mixtures
Unstable purified proteinStorage conditionsTest cryoprotectants, lyophilization options, and temperature stability

Research on similar mouse recombinant proteins indicates that sarkosyl-containing buffers represent a particularly effective approach for maintaining solubility while preserving structural integrity .

What statistical approaches are appropriate for analyzing KIAA1467 expression data in experimental models?

For robust statistical analysis of KIAA1467 expression data:

  • Normalization methods: Apply appropriate normalization techniques based on experimental platform (qPCR, RNA-seq, or protein quantification)

  • Differential expression analysis: Utilize tools like Significance Analysis of Microarrays (SAM) with appropriate false discovery rate (FDR) thresholds

  • Multiple comparison correction: Apply Benjamini-Hochberg or similar procedures when comparing multiple experimental conditions

  • Correlation analysis: Assess relationships between KIAA1467 expression and potential interacting partners or phenotypic outcomes

  • Power analysis: Ensure adequate sample sizes for detecting biologically meaningful differences, particularly in in vivo studies

  • Data visualization: Implement comprehensive plotting approaches including heat maps, volcano plots, and network visualizations

Statistical approaches should be tailored to the specific experimental design and data distribution characteristics, with particular attention to addressing potential sources of technical and biological variability.

How should researchers interpret contradictory results between in vitro and in vivo KIAA1467 studies?

When reconciling contradictory results:

  • Context-dependent function: Consider that KIAA1467 may have different roles in isolated cells versus intact tissue environments

  • Expression level considerations: Evaluate whether different expression levels between systems might explain functional differences

  • Model system limitations: Assess whether the in vitro system accurately recapitulates relevant aspects of the in vivo environment

  • Interaction partner availability: Determine if critical binding partners are present in both systems

  • Post-translational modifications: Examine whether differential modifications explain functional disparities

  • Experimental validation: Design experiments to specifically test hypotheses explaining the contradictions

  • Literature contextualization: Frame findings within broader understanding of related proteins and pathways

This structured approach facilitates resolution of apparent contradictions through systematic hypothesis testing rather than simple dismissal of conflicting data.

What emerging technologies could advance understanding of mouse KIAA1467 function?

Cutting-edge methodologies that could drive KIAA1467 research forward include:

  • Spatial transcriptomics: Map expression patterns with cellular resolution across tissues and developmental stages

  • Single-cell proteomics: Identify cell populations and states where KIAA1467 plays critical roles

  • Cryo-EM: Resolve protein structure at near-atomic resolution, potentially in complex with binding partners

  • Proximity labeling approaches: Identify the protein interactome using BioID or APEX2 fusion constructs

  • Machine learning-based function prediction: Apply computational approaches similar to those used in cancer driver gene prediction

  • Targeted protein degradation: Employ PROTAC technology for acute, specific protein depletion

  • miRNA regulatory network mapping: Evaluate regulation of KIAA1467 by miRNAs using approaches similar to those applied in breast cancer studies

These technologies offer complementary approaches to traditional methods, potentially revealing functions that have remained elusive through conventional techniques.

How might findings about mouse KIAA1467 translate to human disease research?

Translational research considerations include:

  • Conservation analysis: Determine sequence and structural homology between mouse and human KIAA1467 (FAM234B) to assess functional conservation

  • Expression correlation: Compare expression patterns across species in corresponding tissues and developmental stages

  • Disease-associated variants: Examine whether human KIAA1467 harbors variants associated with specific pathologies

  • Pathway conservation: Evaluate whether associated biological pathways are conserved between species

  • Animal model development: Design physiologically relevant models for human diseases potentially involving KIAA1467

  • Cross-species validation: Confirm findings in human cells or tissues to establish relevance

  • Therapeutic target assessment: Evaluate potential based on combined mouse and human data

The human ortholog information, including its 1866 bp ORF size , provides a starting point for cross-species comparisons, while methodologies for target validation can build upon established approaches for recombinant protein research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.