KIAA1467 (Gene name: Kiaa1467) is classified as an uncharacterized protein, indicating that its complete biological functions remain to be fully elucidated through ongoing research. The mouse variant of this protein shares significant homology with the human KIAA1467 counterpart, suggesting potential evolutionary conservation of function across mammalian species . The protein derives its designation from the KIAA naming system, originally established by the Kazusa DNA Research Institute for novel human genes identified through their Human Unidentified Gene-Encoded (HUGE) large-scale cDNA sequencing project .
The mouse ortholog of KIAA1467, designated as mKIAA1467, has been documented by the Kazusa Mouse cDNA Project, establishing a parallel research track that enables comparative studies between human and mouse models . This cross-species approach potentially enhances our understanding of the protein's fundamental biological properties and evolutionary significance. The recombinant form of mouse KIAA1467 protein represents a valuable research tool, enabling controlled investigation of this protein in experimental settings.
The full-length recombinant mouse KIAA1467 protein encompasses 624 amino acids, presenting a comprehensive expression region for structural and functional analyses . The complete amino acid sequence has been determined and consists of the following primary structure:
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQQKNGGVKNGKSALGDLPE
PDSDADVAGAAKPHLSEVTPEGFPSEPLGGLEQKATSPLVSYVRTSVFLLTLVISMVLVL
LCAFLIPCPPRDLHSAWSRRLGSQGGGDLSPLELADVNRDGLRDVLLTFVTTRNGTEGGV
GSQPTADLVCLSGMNGSTLWSSPLPEEAQDVTCLDLIPGSVAKVTCLVTGTRKLSAFNA
TSGKVLWTLNPNHLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGS
PVGRPVKYNIVGVGNLIGPQVYITASGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSL
QIEEPEWEKHRSVNLSELIDVYSDGVELLQLVKAPDSNSSSLLITTRQGLVLLRGQDLTP
HWKLNLQGLRSQPTPGYFTDDQTLDFLLQTQDGDGMKKMTVVDGGSGSIVWSYSIPCHMK
ETPTTSAITSDQKSVFLFWAEALTAASLSSDDSSGAEPPGLYHLYLLHPAFPSILLDLSN
TTGIVTASEVGINDIWKDAFYVTRTTGMSPEGHPTSLVVSKLSLRWALMEGQMVQLKETT
PKIGRGELRRFLSRIKFVDSPYQI
Analysis of this sequence reveals several notable characteristics. The protein includes multiple domains and motifs that suggest potential membrane association, as indicated by hydrophobic regions that could function as transmembrane segments. The presence of conserved sequences across species further suggests functional importance, though specific enzymatic or signaling activities remain to be characterized through targeted biochemical studies.
The mouse Kiaa1467 gene is located on chromosome 12 and comprises 10 exons, as determined through genomic mapping studies . This genomic organization potentially provides insights into the evolutionary history of the gene and its regulatory mechanisms. The gene structure shows significant conservation with its human counterpart, supporting the hypothesis of preserved biological function across mammalian lineages.
The recombinant mouse KIAA1467 protein is produced through advanced molecular cloning and expression techniques, enabling the generation of purified protein for research applications . While the specific expression system is not explicitly detailed in the available sources, recombinant proteins of this nature are typically produced in prokaryotic (E. coli) or eukaryotic (insect or mammalian) cell systems depending on requirements for post-translational modifications and proper folding.
The commercially available recombinant protein is typically supplied with a molecular tag to facilitate purification and detection, though the specific tag type may vary and is determined during the production process . This approach ensures high purity and yield while maintaining the protein's structural integrity and potential functional activity.
While the precise biological functions of KIAA1467 remain uncharacterized, computational analysis of its amino acid sequence suggests the presence of several conserved domains that may provide clues to its cellular roles. The sequence contains motifs consistent with:
Potential membrane association, suggested by hydrophobic regions
Possible protein-protein interaction domains
Sequences that may participate in cellular signaling pathways
Further experimental validation is required to confirm these computational predictions and establish the protein's definitive functions in cellular contexts.
The recombinant mouse KIAA1467 protein serves as a valuable research tool in multiple experimental contexts:
Generation of specific antibodies for immunological detection and localization studies
Identification of binding partners through protein-protein interaction screening
Functional assays to investigate potential enzymatic or signaling activities
Structural studies using X-ray crystallography or cryo-electron microscopy
Comparative analyses between mouse and human orthologs
These applications contribute to expanding our understanding of this uncharacterized protein and may ultimately reveal its significance in normal physiology and potential involvement in disease processes.
Despite the availability of recombinant KIAA1467 protein and sequence information, significant knowledge gaps remain regarding:
Tissue-specific expression patterns and subcellular localization
Developmental regulation and temporal expression dynamics
Interaction networks and signaling pathway involvement
Phenotypic consequences of gene deletion or overexpression
Potential associations with disease states or physiological processes
These limitations highlight the need for comprehensive research approaches combining genomic, proteomic, and functional studies to fully characterize this protein.
To advance understanding of KIAA1467, several research priorities emerge:
Generation of knockout and conditional knockout mouse models to study phenotypic consequences
Comprehensive protein interaction mapping using advanced proteomics techniques
Structure determination through crystallography or cryo-EM approaches
Tissue-specific expression profiling across developmental stages
Investigation of potential roles in human diseases through translational research
Such multidisciplinary approaches would significantly expand the knowledge base regarding this uncharacterized protein and potentially reveal novel biological mechanisms or therapeutic targets.
Mouse KIAA1467 (also known as FAM234B) is an uncharacterized protein that shares structural homology with its human ortholog. The human version has an ORF size of 1866 bp, potentially indicating similar characteristics in the mouse variant . As an uncharacterized protein, it represents a frontier for discovery in molecular biology, with potential implications for understanding novel cellular pathways, protein-protein interactions, and possible roles in disease mechanisms. Research interest stems from elucidating its function, expression patterns, and potential involvement in developmental or pathological processes.
Based on similar recombinant mouse protein studies, prokaryotic expression systems, particularly E. coli strains like BL21(DE3), offer efficient platforms for initial characterization work. For mouse KIAA1467, a prokaryotic system optimized with Terrific Broth (TB) culture medium can yield significant protein quantities under controlled induction conditions. Alternative systems include mammalian cell lines for proteins requiring post-translational modifications, yeast systems for moderate modifications, and baculovirus-insect cell systems for complex eukaryotic proteins . The choice depends on research objectives - prokaryotic systems work well for structural studies while mammalian systems may better preserve functionality for interaction studies.
When designing expression vectors for mouse KIAA1467, researchers should consider:
Promoter selection: Strong inducible promoters like T7 for prokaryotic systems or CMV for mammalian systems
Fusion tags: Addition of purification tags (His, GST, or MBP) that facilitate downstream purification while minimizing impact on protein folding
Inclusion of immunostimulatory sequences: For immunogenicity studies, incorporate peptides like tetanus toxin P2P30 and PADRE, which significantly enhance humoral immune responses as demonstrated in similar mouse protein studies
Codon optimization: Adjust codons to match expression host preferences
Cleavage sites: Include protease recognition sequences for tag removal
Regulatory elements: Incorporate appropriate enhancers, terminators, and selection markers
The vector backbone should be compatible with the target expression system, with appropriate resistance markers for selection.
For prokaryotic expression of mouse recombinant proteins similar to KIAA1467, optimal conditions include:
| Parameter | Optimal Condition | Notes |
|---|---|---|
| E. coli strain | BL21(DE3) | Deficient in lon and ompT proteases |
| Culture medium | Terrific Broth (TB) | Superior to LB for protein yield |
| IPTG concentration | 0.25 mM | Higher concentrations may not improve yield |
| Induction temperature | 15°C | Lower temperatures reduce inclusion body formation |
| Induction duration | 24 hours | Extended time increases yield for difficult proteins |
| Optical density at induction | 0.6-0.8 at 600nm | Mid-log phase offers balance of growth and expression |
These parameters have been shown to significantly improve yield and solubility for recombinant mouse proteins in prokaryotic systems . Temperature is particularly critical - induction at 15°C rather than standard 37°C dramatically improves proper folding for many mammalian proteins expressed in bacterial systems.
A multi-step purification strategy is recommended for maximum purity:
Initial extraction: For mouse recombinant proteins, buffers containing 2% sarkosyl have demonstrated superior yield and purity compared to standard lysis buffers
Affinity chromatography: Utilize the fusion tag (His, GST) for initial capture
Ion exchange chromatography: Based on the theoretical isoelectric point of KIAA1467
Size exclusion chromatography: For final polishing and buffer exchange
This approach typically yields >95% pure protein suitable for downstream applications including structural studies, antibody production, and functional assays. The inclusion of sarkosyl in extraction buffers is particularly effective for improving solubilization while maintaining native-like protein conformations.
Enhancing solubility of recombinant mouse proteins requires multiple optimization strategies:
Temperature modulation: Lower induction temperatures (15°C) dramatically improve folding kinetics
Co-expression with chaperones: GroEL/ES, DnaK systems facilitate proper folding
Fusion partners: Solubility-enhancing tags like MBP, SUMO, or Thioredoxin
Solubilizing agents: 2% sarkosyl in extraction buffers improves solubilization while maintaining better structural integrity than traditional detergents like Triton X-100
Rare codon supplementation: Co-express rare tRNAs using plasmids like pRARE
Reduced induction strength: Lower IPTG concentrations (0.25 mM) for slower, more accurate folding
These approaches can be implemented individually or in combination, with systematic optimization for KIAA1467-specific requirements.
Multiple complementary techniques should be employed for thorough validation:
Western Blotting: Using antibodies against the fusion tag or against KIAA1467 specifically
Mass Spectrometry: For accurate mass determination and sequence verification
ELISA: Confirming antigenicity and epitope preservation
Circular Dichroism: Evaluating secondary structure integrity
Dynamic Light Scattering: Assessing homogeneity and aggregation state
Functional Assays: Based on predicted functions or protein-protein interactions
Research on similar mouse recombinant proteins demonstrates that combining Western Blotting and ELISA provides reliable validation of protein identity and preservation of critical epitopes .
Since KIAA1467 is largely uncharacterized, functional assessment may require:
Binding assays with predicted interaction partners based on bioinformatic analysis
Cell-based assays examining effects on relevant signaling pathways
Comparative analysis with orthologs: Utilizing known information about human KIAA1467 (FAM234B)
Immunogenicity testing: If investigating as a potential antigen, evaluate humoral response generation in mouse models, comparing constructs with and without immunostimulatory peptides
Protein-protein interaction screening: Using techniques like pull-down assays or yeast two-hybrid systems to identify binding partners
Structural characterization: X-ray crystallography or NMR to inform function
The approach should combine hypothesis-driven experiments with unbiased screening methods to elucidate function.
For cancer research applications, recombinant KIAA1467 can be employed in several sophisticated approaches:
Expression profiling: Compare KIAA1467 expression across cancer and normal tissue using validated antibodies generated against the recombinant protein
Driver gene analysis: Assess whether KIAA1467 harbors mutations that confer selective advantage to cancer cells using methodology similar to that applied in driver gene prediction models
Protein-protein interaction mapping: Identify cancer-relevant binding partners using the purified recombinant protein as bait
Immunotherapy potential: Evaluate as a cancer-testis antigen candidate using the immunization protocol outlined for mouse placental proteins
miRNA regulation studies: Investigate whether KIAA1467 is regulated by miRNAs identified in breast cancer studies, applying target prediction databases like TargetScan, PicTar, and miRanda
These approaches leverage the purified recombinant protein to explore potential oncological relevance through multiple experimental paradigms.
For genetic modification studies targeting KIAA1467:
Complete knockout vs. conditional systems: Consider temporal and tissue-specific regulation using Cre-Lox or tetracycline-inducible systems
Guide RNA design for CRISPR/Cas9: Target functionally critical domains predicted through bioinformatic analysis
Off-target effects: Perform thorough in silico prediction and experimental validation
Knockdown alternatives: Design shRNA or siRNA targeting multiple regions of KIAA1467 transcript
Phenotypic assessment strategy: Develop comprehensive panel of assays based on predicted functions
Rescue experiments: Use the validated recombinant protein to confirm specificity of observed phenotypes
Controls: Include appropriate wild-type and scrambled or non-targeting controls
The recombinant protein serves as a critical reagent for antibody validation and rescue experiments in these genetic studies.
When encountering low expression yields:
Expression vector optimization: Re-evaluate promoter strength, codon optimization, and mRNA stability elements
Strain selection: Test multiple E. coli strains beyond BL21(DE3), such as Rosetta, Arctic Express, or Origami for proteins with disulfide bonds
Expression conditions: Systematically vary temperature (15-37°C), IPTG concentration (0.1-1 mM), and induction time (4-24 hours)
Media formulation: Compare TB, LB, 2xYT, and auto-induction media
Co-expression strategies: Include chaperones, rare tRNAs, or disulfide isomerases
Toxicity assessment: Evaluate growth curves to determine if the protein is toxic to host cells
A structured optimization approach examining these parameters individually and in combination typically resolves yield issues for challenging recombinant proteins.
For addressing solubility challenges:
Research on similar mouse recombinant proteins indicates that sarkosyl-containing buffers represent a particularly effective approach for maintaining solubility while preserving structural integrity .
For robust statistical analysis of KIAA1467 expression data:
Normalization methods: Apply appropriate normalization techniques based on experimental platform (qPCR, RNA-seq, or protein quantification)
Differential expression analysis: Utilize tools like Significance Analysis of Microarrays (SAM) with appropriate false discovery rate (FDR) thresholds
Multiple comparison correction: Apply Benjamini-Hochberg or similar procedures when comparing multiple experimental conditions
Correlation analysis: Assess relationships between KIAA1467 expression and potential interacting partners or phenotypic outcomes
Power analysis: Ensure adequate sample sizes for detecting biologically meaningful differences, particularly in in vivo studies
Data visualization: Implement comprehensive plotting approaches including heat maps, volcano plots, and network visualizations
Statistical approaches should be tailored to the specific experimental design and data distribution characteristics, with particular attention to addressing potential sources of technical and biological variability.
When reconciling contradictory results:
Context-dependent function: Consider that KIAA1467 may have different roles in isolated cells versus intact tissue environments
Expression level considerations: Evaluate whether different expression levels between systems might explain functional differences
Model system limitations: Assess whether the in vitro system accurately recapitulates relevant aspects of the in vivo environment
Interaction partner availability: Determine if critical binding partners are present in both systems
Post-translational modifications: Examine whether differential modifications explain functional disparities
Experimental validation: Design experiments to specifically test hypotheses explaining the contradictions
Literature contextualization: Frame findings within broader understanding of related proteins and pathways
This structured approach facilitates resolution of apparent contradictions through systematic hypothesis testing rather than simple dismissal of conflicting data.
Cutting-edge methodologies that could drive KIAA1467 research forward include:
Spatial transcriptomics: Map expression patterns with cellular resolution across tissues and developmental stages
Single-cell proteomics: Identify cell populations and states where KIAA1467 plays critical roles
Cryo-EM: Resolve protein structure at near-atomic resolution, potentially in complex with binding partners
Proximity labeling approaches: Identify the protein interactome using BioID or APEX2 fusion constructs
Machine learning-based function prediction: Apply computational approaches similar to those used in cancer driver gene prediction
Targeted protein degradation: Employ PROTAC technology for acute, specific protein depletion
miRNA regulatory network mapping: Evaluate regulation of KIAA1467 by miRNAs using approaches similar to those applied in breast cancer studies
These technologies offer complementary approaches to traditional methods, potentially revealing functions that have remained elusive through conventional techniques.
Translational research considerations include:
Conservation analysis: Determine sequence and structural homology between mouse and human KIAA1467 (FAM234B) to assess functional conservation
Expression correlation: Compare expression patterns across species in corresponding tissues and developmental stages
Disease-associated variants: Examine whether human KIAA1467 harbors variants associated with specific pathologies
Pathway conservation: Evaluate whether associated biological pathways are conserved between species
Animal model development: Design physiologically relevant models for human diseases potentially involving KIAA1467
Cross-species validation: Confirm findings in human cells or tissues to establish relevance
Therapeutic target assessment: Evaluate potential based on combined mouse and human data
The human ortholog information, including its 1866 bp ORF size , provides a starting point for cross-species comparisons, while methodologies for target validation can build upon established approaches for recombinant protein research .