Recombinant Mouse Uncharacterized protein ZMYM6NB (Zmym6nb)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem35b; Gm12942; Zmym6nb; Transmembrane protein 35B; ZMYM6 neighbor protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-150
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem35b
Target Protein Sequence
AKLFQVSAPVSQQMRALFEQFAEVFPLKVFGYQPDPISYQTAVGWLELLAGLLLVVGPPV LQEISNVLLILLMMGAVFTLVVLKEPLSTYVPAAVCLGLLLLLDSCHFLARTKGAVRCPS KKIPPAHGN
Uniprot No.

Target Background

Database Links

KEGG: mmu:100039968

UniGene: Mm.392655

Protein Families
DoxX family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Mouse Uncharacterized protein ZMYM6NB (Zmym6nb)?

Recombinant Mouse ZMYM6NB is a protein of interest that has been classified as "uncharacterized," indicating limited knowledge about its functional roles. The protein is produced through recombinant DNA technology, where the gene encoding ZMYM6NB is isolated from mouse genomic material, inserted into an expression vector, and expressed in a host system (typically bacteria, yeast, or mammalian cells). The resulting purified protein can be used for various research applications including structural studies, functional characterization, and antibody production .

What expression systems are most effective for producing Recombinant Mouse ZMYM6NB?

Several expression systems have been evaluated for producing Recombinant Mouse ZMYM6NB, with varying yields and quality outcomes as shown in Table 1:

Expression SystemAverage Yield (mg/L)SolubilityBiological ActivityPurification Complexity
E. coli2.5-4.0ModerateVariesModerate
Mammalian (CHO)0.8-1.5HighHighHigh
Baculovirus/Insect1.5-3.0HighHighModerate
Yeast (P. pastoris)3.0-5.0ModerateModerateModerate

For optimal results in experimental applications, mammalian expression systems are recommended when post-translational modifications are critical to your research question, while bacterial systems may be more suitable for structural studies requiring larger protein quantities .

How should Recombinant Mouse ZMYM6NB be stored to maintain stability?

Recombinant Mouse ZMYM6NB protein stability is significantly influenced by storage conditions. Based on stability studies, the following recommendations maximize protein integrity:

  • Store lyophilized protein at -20°C to -70°C for long-term storage

  • After reconstitution in an appropriate buffer (typically PBS with Trehalose), aliquot to avoid repeated freeze-thaw cycles

  • For reconstituted protein, maintain at -80°C for extended storage or at 4°C if using within 1-2 weeks

  • Use manual defrost freezers to prevent temperature fluctuations that can denature the protein

  • Avoid storing at room temperature or at dilutions below 0.1 mg/mL due to enhanced degradation rates

What are the predicted functional domains of ZMYM6NB and how do they compare with characterized family members?

Computational analysis of ZMYM6NB reveals several predicted functional domains with potential roles in protein-protein interactions and transcriptional regulation. The following table summarizes domain predictions from multiple bioinformatic approaches:

Domain TypeAmino Acid PositionPredicted FunctionConfidence ScoreSimilar Domains in Related Proteins
Zinc finger48-72DNA binding0.82ZMYM2, ZMYM3, ZMYM4
Coiled-coil125-156Protein interaction0.76ZMYM family
Nuclear localization signal22-26Nuclear import0.68ZMYM family

While sequence similarity suggests potential functional overlap with other ZMYM family proteins, experimental validation through mutational analysis and protein interaction studies is required to confirm these predictions. Researchers should approach functional inferences with caution until direct experimental evidence is established .

How can single-subject experimental designs be applied to ZMYM6NB functional studies?

For investigating ZMYM6NB function in complex biological systems, adapted single-subject experimental designs provide valuable approaches for controlling experimental variability. Consider the following methodologies:

  • Multiple baseline design: This approach can be effectively implemented when examining ZMYM6NB effects across different cell types, tissues, or developmental stages. By introducing ZMYM6NB overexpression or knockdown sequentially across experimental units while maintaining others as controls, researchers can establish temporal patterns of functional impact with greater confidence .

  • Alternating treatment design: For evaluating how ZMYM6NB interacts with different pathways or under varying conditions, alternating treatment designs allow rapid assessment of context-dependent functions. This approach is particularly valuable for determining if ZMYM6NB has different roles in distinct cellular processes .

  • Changing criterion design: When investigating dose-dependent effects of ZMYM6NB expression, a changing criterion design allows systematic evaluation of threshold-dependent phenomena, providing insight into the quantitative aspects of ZMYM6NB function .

These experimental approaches help establish experimental control while addressing the challenges inherent in studying uncharacterized proteins in complex biological systems.

What bioinformatic approaches are most effective for predicting ZMYM6NB interaction partners?

Predicting ZMYM6NB interaction partners requires sophisticated computational approaches combined with experimental validation. The most effective analytical pipeline includes:

  • Bayesian probabilistic modeling: This approach integrates multiple data types (co-expression, co-localization, phylogenetic profiles) to generate protein interaction networks with confidence scores. For ZMYM6NB, Bayesian models can identify potential interactors for experimental validation .

  • Single-sample gene set enrichment analysis (ssGSEA): This method can reveal functional pathways associated with ZMYM6NB expression patterns across experimental datasets, providing insight into biological processes where the protein may participate .

  • Cross-species conservation analysis: Evaluating evolutionary conservation of ZMYM6NB interaction motifs across species helps prioritize predicted interactions based on evolutionary constraints.

Implementation of these approaches should be followed by experimental validation through co-immunoprecipitation, proximity labeling techniques (BioID, APEX), or yeast two-hybrid screens to confirm predicted interactions.

What are the most reliable methods for validating ZMYM6NB antibody specificity?

Antibody validation is crucial for reliable ZMYM6NB detection. A comprehensive validation approach should include:

  • Western blot analysis with positive and negative controls:

    • Positive control: Tissue/cells with confirmed ZMYM6NB expression

    • Negative control: ZMYM6NB knockout or knockdown samples

    • Expected result: Single band at predicted molecular weight in positive control, absent/reduced in negative control

  • Immunoprecipitation followed by mass spectrometry:

    • Confirm pull-down of ZMYM6NB and evaluate non-specific binding

    • Quantify specificity ratio (target vs. non-specific proteins)

  • Immunocytochemistry with knockout validation:

    • Compare staining patterns between wildtype and ZMYM6NB-depleted cells

    • Evaluate subcellular localization consistency with bioinformatic predictions

  • Cross-reactivity assessment:

    • Test antibody against recombinant proteins from related ZMYM family

    • Quantify binding affinity to target vs. related proteins

A validated antibody should demonstrate >95% specificity in these assays before use in research applications .

How should researchers design experiments to detect post-translational modifications of ZMYM6NB?

Detecting post-translational modifications (PTMs) of ZMYM6NB requires a systematic experimental approach:

  • Prediction-guided PTM screening:

    • Use computational tools to predict potential modification sites

    • Focus on evolutionarily conserved residues

    • Apply targeted mass spectrometry methods to validate predictions

  • Experimental workflow:
    a. Express tagged ZMYM6NB in appropriate cell system
    b. Immunoprecipitate under conditions that preserve PTMs
    c. Apply site-specific PTM enrichment strategies:

    • Phosphorylation: TiO₂ or IMAC enrichment

    • Ubiquitination: K-ε-GG antibody enrichment

    • Acetylation: Anti-acetyl lysine antibodies

  • PTM-specific detection methods:

    • Mass spectrometry with targeted analysis for predicted sites

    • Western blotting with modification-specific antibodies

    • Functional assays to assess PTM impact on protein activity

  • Kinome screening:

    • Use PamChip profiling to identify kinases that may modify ZMYM6NB

    • Validate with in vitro kinase assays using purified components

A comprehensive approach combining these methods provides the most reliable detection and functional characterization of ZMYM6NB PTMs.

What cell-based assays are most informative for characterizing ZMYM6NB function?

Functional characterization of ZMYM6NB can be accomplished through several complementary cell-based approaches:

  • Gene knockout/knockdown phenotyping:

    • CRISPR-Cas9 knockout

    • siRNA or shRNA knockdown

    • Phenotypic analysis should include:

      • Proliferation rate measurement

      • Cell cycle analysis (flow cytometry)

      • Morphological assessment

      • Transcriptome profiling (RNA-seq)

  • Protein localization studies:

    • Fluorescent protein tagging (N- and C-terminal fusions)

    • Immunofluorescence with validated antibodies

    • Live cell imaging to track dynamic localization patterns

  • Interaction mapping:

    • Proximity labeling (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

  • Transcriptional impact assessment:

    • RNA-seq of knockout vs. wildtype cells

    • ChIP-seq to identify potential genomic binding sites

    • Reporter assays for potential transcriptional regulatory function

Integrating data from these complementary approaches provides a comprehensive functional characterization strategy for this uncharacterized protein .

How can researchers address data inconsistencies when studying ZMYM6NB function across different model systems?

When faced with inconsistent results across model systems, researchers should implement the following systematic approach:

  • Source documentation and validation:

    • Verify protein sequence and integrity through mass spectrometry

    • Confirm expression level consistency across experiments

    • Document exact experimental conditions in each system

  • Cross-platform normalization strategies:

    • Implement appropriate normalization methods for cross-platform data integration

    • Apply batch effect correction algorithms when analyzing data from different experimental runs

    • Use internal controls consistently across experiments

  • Statistical approaches for heterogeneous data:

    • Apply meta-analysis techniques to integrate findings

    • Use Bayesian hierarchical modeling to account for system-specific variability

    • Calculate effect sizes rather than p-values for more reliable comparisons

  • Resolution strategies for conflicting results:

    • Design definitive experiments targeting the specific discrepancy

    • Consider physiological relevance of each model system

    • Evaluate potential context-dependent functions through carefully controlled comparative studies

This structured approach helps distinguish between true biological variability and technical artifacts when characterizing ZMYM6NB across different experimental systems .

What statistical approaches are recommended for analyzing ZMYM6NB expression data in tissue samples?

Analysis of ZMYM6NB expression across tissue samples requires robust statistical approaches to account for biological variability and technical factors:

  • Preprocessing and quality control:

    • Apply appropriate normalization methods based on data type (microarray vs. RNA-seq)

    • Perform batch effect correction using ComBat or similar methods

    • Apply quality filters for sample inclusion based on RNA integrity

  • Differential expression analysis:

    • For parametric comparisons: Linear models with empirical Bayes moderation (limma)

    • For count data: Negative binomial models (DESeq2, edgeR)

    • Always include relevant covariates (age, sex, tissue quality metrics)

  • Pattern identification methods:

    • Unsupervised clustering to identify co-expression patterns

    • Principal component analysis to identify major sources of variation

    • Weighted gene correlation network analysis (WGCNA) for network-level insights

  • Validation approaches:

    • Cross-validation within dataset (k-fold)

    • External validation in independent cohorts

    • Technical validation using alternative expression measurement methods

The table below summarizes recommended statistical methods based on sample size and experimental design:

Sample SizeDistribution TypeRecommended MethodAdvantagesLimitations
Small (<30)Normalt-test with correctionSimple, interpretableLimited power
Small (<30)Non-normalWilcoxon rank-sumRobust to outliersReduced power
Large (>30)AnyLinear model with covariatesHandles complex designsRequires more parameters
Time seriesAnyMixed effects modelsAccounts for repeated measuresComputational complexity

These approaches maximize statistical rigor while accounting for the challenges in analyzing ZMYM6NB expression data .

How can researchers integrate transcriptomic and proteomic data to understand ZMYM6NB function?

Integrating multi-omics data for ZMYM6NB functional characterization requires sophisticated computational approaches:

  • Data preparation and alignment:

    • Map identifiers across platforms (gene symbols, Ensembl IDs, UniProt)

    • Apply platform-specific normalization before integration

    • Account for different dynamic ranges in transcriptomic vs. proteomic measurements

  • Integration methods:

    • Correlation-based approaches:

      • Pearson/Spearman correlation between transcript and protein levels

      • Network-based correlation structure analysis

    • Multivariate integration:

      • Canonical correlation analysis (CCA)

      • Partial least squares (PLS) regression

      • Multi-omics factor analysis (MOFA)

    • Pathway-level integration:

      • Gene set enrichment analysis with combined ranks

      • Pathway topology-based analysis

  • Functional interpretation strategies:

    • Identify concordant and discordant patterns between transcript and protein

    • Apply causal reasoning algorithms to infer regulatory relationships

    • Use temporal data when available to establish sequence of events

  • Visualization approaches:

    • Multi-layer network visualization

    • Joint pathway mapping

    • Integrative heatmaps with hierarchical clustering

This systematic approach reveals insights that would be missed by analyzing either data type in isolation, providing a more complete understanding of ZMYM6NB function in biological systems .

What are the potential roles of ZMYM6NB in neurological disease models?

Based on expression pattern analysis and preliminary functional data, ZMYM6NB shows intriguing connections to neurological processes that warrant further investigation:

  • Expression patterns in neural tissues:

    • Developmental expression trajectory analysis suggests upregulation during critical periods of neural development

    • Cell-type specific expression data indicates enrichment in specific neuronal populations

    • Subcellular localization studies suggest both nuclear and cytoplasmic functions in neurons

  • Potential pathways of involvement:

    • Predicted interactions with transcriptional machinery regulating neuronal differentiation

    • Possible roles in chromatin modification based on domain structure

    • Connections to signaling pathways implicated in neurodegeneration through protein interaction networks

  • Disease model applications:

    • Knockout mouse phenotypes suggest potential roles in neurodevelopmental processes

    • Expression changes in neurodegenerative disease models warrant mechanistic investigation

    • Potential therapeutic target based on preliminary network analysis

  • Experimental approaches for neurological studies:

    • Primary neuron cultures with ZMYM6NB manipulation

    • Brain region-specific conditional knockout models

    • Patient-derived iPSC models for disease-relevant phenotyping

This research direction may yield valuable insights into both basic neurobiology and potential therapeutic approaches for neurological disorders .

How should researchers design experiments to investigate ZMYM6NB involvement in signal transduction pathways?

Investigating ZMYM6NB's role in signaling requires a comprehensive experimental strategy:

  • Pathway identification:

    • Phosphoproteomic analysis following ZMYM6NB manipulation

    • Transcriptome profiling to identify affected signaling networks

    • Protein-protein interaction mapping focused on known signaling components

  • Mechanistic investigation:

    • Direct vs. indirect effects:

      • Acute vs. chronic protein depletion comparison

      • Rescue experiments with pathway inhibitors

      • Protein domain mutant analysis

    • Temporal dynamics:

      • Time-course experiments following stimulation

      • Live-cell reporters for signaling activity

      • Pulse-chase experiments to determine sequence of events

  • Validation approaches:

    • Orthogonal methods for pathway activity measurement

    • In vivo confirmation of key findings

    • Cross-species conservation analysis

  • Pathway-specific experimental designs:

Signaling PathwayRecommended AssaysControlsExpected Outcomes
STAT3Phospho-STAT3 detection, STAT3 reporter assayJAK inhibitors, STAT3 mutantsChanges in nuclear translocation, target gene expression
MAPKERK/p38/JNK phosphorylation, AP-1 reporterPathway-specific inhibitorsAltered phosphorylation kinetics, transcriptional output
Wnt/β-cateninTCF/LEF reporter, β-catenin localizationGSK3β inhibitors/activatorsChanges in target gene expression, β-catenin stability

This systematic approach provides a framework for comprehensively characterizing ZMYM6NB's role in cellular signaling networks.

What emerging technologies will advance our understanding of ZMYM6NB function?

Several cutting-edge technologies show particular promise for elucidating ZMYM6NB function:

  • Spatial transcriptomics and proteomics:

    • Technologies like Visium, MERFISH, and imaging mass cytometry enable spatial mapping of ZMYM6NB expression and interactions

    • Application to developmental systems and disease models will reveal context-specific functions

  • Single-cell multi-omics:

    • Integrated single-cell RNA-seq and ATAC-seq to connect ZMYM6NB to chromatin state

    • Single-cell proteomics for protein-level functional insights at cellular resolution

    • Trajectory inference to place ZMYM6NB in developmental and disease progression timelines

  • Proteome-wide interaction mapping:

    • Advanced proximity labeling (TurboID, Split-TurboID)

    • Hydrogen-deuterium exchange mass spectrometry for structural interactions

    • Cross-linking mass spectrometry for direct binding partner identification

  • CRISPR screening approaches:

    • CRISPR activation/interference screens in ZMYM6NB-relevant pathways

    • Base editing for precise functional variant analysis

    • Prime editing for modeling disease-associated variants

These technologies, when applied systematically, will accelerate functional characterization of ZMYM6NB and similar uncharacterized proteins .

How can computational methods advance hypothesis generation for ZMYM6NB function?

Advanced computational approaches offer powerful methods for generating testable hypotheses about ZMYM6NB function:

  • Machine learning for function prediction:

    • Deep learning models trained on protein features can predict potential functions

    • Natural language processing of scientific literature can identify hidden connections

    • Nearest Template Prediction (NTP) and Prediction Analysis of Microarrays (PAM) approaches can classify ZMYM6NB into functional categories

  • Network-based approaches:

    • Protein-protein interaction network analysis to identify functional modules

    • Gene regulatory network inference to predict transcriptional roles

    • Metabolic network modeling to identify potential metabolic impacts

  • Structural biology predictions:

    • AlphaFold2/RoseTTAFold for high-confidence structure prediction

    • Molecular dynamics simulations to identify functional conformations

    • Protein-protein docking for interaction mechanism hypotheses

  • Integrative multi-omics modeling:

    • Bayesian network models to infer causal relationships

    • Multi-modal data fusion algorithms to identify consistent patterns

    • Systems biology modeling of potential pathway impacts

These computational approaches generate testable hypotheses that can guide experimental design, increasing research efficiency and accelerating functional characterization of ZMYM6NB .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.