Recombinant Mouse UPF0258 protein KIAA1024-like homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse UPF0258 Protein KIAA1024-Like Homolog

The Recombinant Mouse UPF0258 protein KIAA1024-like homolog, also known as Minar2 (Membrane integral NOTCH2-associated receptor 2), is a protein that is expressed and purified from different hosts, including E. coli and yeast, for optimal yields and turnaround times . Expression in insect or mammalian cells can provide post-translational modifications that support correct protein folding and retain protein activity .

Gene Information

The UPF0258 protein KIAA1024-like homolog is part of the UPF0258 gene family, which includes KIAA1024/Minar1/Ubtor . Kiaa1024L/Minar2 gene orthologs are found in vertebrate species .

  • Gene Name: UPF0258 protein KIAA1024-like homolog

  • Synonyms: Minar2; Major intrinsically disordered NOTCH2-binding receptor 1-like homolog; Membrane integral NOTCH2-associated receptor 2

  • UniProt ID: Q8C4X7

Protein Properties

Recombinant Full Length Mouse UPF0258 protein KIAA1024-like homolog Protein, His-Tagged:

CategoryDescription
SpeciesMus musculus
SourceE. coli
TagHis
Protein LengthFull Length (1-151aa)
FormLyophilized powder
AA SequenceMPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASMSSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGDTYTPGFDTLLKEKKKRNKRSKLCHMGLILLLVASILVTIVTLSTIFS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development according to your specification.
Synonyms
Minar2; Major intrinsically disordered NOTCH2-binding receptor 1-like homolog; Membrane integral NOTCH2-associated receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASMSSVMKNNPLYGDITL EEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGDTYTPGFDTLLKEKKKR NKRSKLCHMGLILLLVASILVTIVTLSTIFS
Uniprot No.

Target Background

Database Links

UniGene: Mm.209711

Protein Families
UPF0258 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UPF0258 protein KIAA1024-like homolog and what are its basic structural characteristics?

UPF0258 protein KIAA1024-like homolog (Minar2) is a protein-coding gene product with a full length of 151 amino acids in mouse (Mus musculus). It belongs to the UPF0258 gene family and can be recombinantly expressed in prokaryotic systems such as E. coli with purification tags like His-tag . The protein is conserved across species, with homologs identified in various vertebrates including Chinese soft-shelled turtle (Pelodiscus sinensis) . Methodologically, researchers characterize its structure through techniques like X-ray crystallography, NMR spectroscopy, or cryo-EM, though specific structural details may still be under investigation.

What expression systems are recommended for recombinant production of mouse UPF0258 protein KIAA1024-like homolog?

E. coli is the most commonly utilized expression system for recombinant production of mouse UPF0258 protein KIAA1024-like homolog, particularly when producing the full-length protein (1-151 amino acids) with affinity tags such as His-tag for purification purposes . For researchers seeking to produce recombinant UPF0258 protein, the methodology typically involves:

  • Cloning the coding sequence into an appropriate expression vector

  • Transforming the construct into a compatible E. coli strain (e.g., BL21(DE3))

  • Inducing protein expression with IPTG or similar inducers

  • Purifying the protein using affinity chromatography techniques based on the attached tag

For experimental applications requiring post-translational modifications, mammalian or insect cell expression systems may be more appropriate, though specific protocols for these systems with this particular protein are not detailed in the provided search results.

How can researchers verify the identity and purity of recombinant mouse UPF0258 protein KIAA1024-like homolog?

Methodologically, researchers should employ multiple complementary approaches:

  • SDS-PAGE analysis to confirm molecular weight (expected size for the full-length mouse protein is approximately 17 kDa plus the weight of any tags)

  • Western blotting with specific antibodies against the protein or tag

  • Mass spectrometry for precise molecular weight determination and peptide mapping

  • Circular dichroism (CD) to assess secondary structure elements

  • Size-exclusion chromatography to evaluate protein homogeneity and oligomerization state

The purity assessment should target >90% homogeneity for most experimental applications, with higher standards (>95%) for structural and functional studies.

What is known about the physiological function of UPF0258 protein KIAA1024-like homolog in mouse models?

Research indicates that Kiaa1024L/Minar2 plays a crucial role in auditory function by regulating cholesterol homeostasis . In zebrafish models, studies have shown that mutation of minar2 leads to hearing deficits, though the phenotype appears less severe than in mouse models . The methodological approach to characterizing the physiological function typically involves:

  • Generation of knockout or knockdown models (using CRISPR-Cas9 or similar gene-editing technologies)

  • Phenotypic characterization through behavioral and physiological tests (particularly auditory function tests)

  • Histological examination of relevant tissues (inner ear structures)

  • Molecular characterization of affected pathways (particularly cholesterol metabolism)

Interestingly, there may be compensatory mechanisms involving other genes outside the UPF0258 family that partially rescue the phenotype in certain model organisms, which explains the variation in phenotypic severity across species .

How does UPF0258 protein KIAA1024-like homolog influence cholesterol regulation in cellular systems?

UPF0258 protein KIAA1024-like homolog (Minar2) appears to be essential for proper cholesterol regulation, particularly in specialized cellular contexts such as hair cells of the inner ear . The methodological approaches to investigate this function include:

  • Fluorescent cholesterol sensors or stains (e.g., filipin) to visualize and quantify cholesterol distribution in wild-type versus knockout/knockdown models

  • Lipidomic analyses to measure precise changes in cellular cholesterol and related lipid species

  • Protein-lipid interaction assays to determine direct binding between Minar2 and cholesterol or other lipids

  • Gene expression analyses to identify downstream effectors in cholesterol metabolism pathways

The connection between cholesterol regulation and hearing function suggests that Minar2 may play a specialized role in maintaining the unique lipid composition required for proper mechanotransduction in auditory hair cells .

What are the most effective methods for studying the role of UPF0258 protein KIAA1024-like homolog in hearing function?

Advanced methodological approaches for investigating the role of UPF0258 protein KIAA1024-like homolog (Minar2) in hearing function include:

  • Targeted gene editing in animal models: Generate conditional knockouts specifically in inner ear hair cells using Cre-loxP systems to avoid potential developmental compensatory mechanisms

  • Electrophysiological recordings: Measure hair cell function through patch-clamp techniques to assess mechanotransduction properties

  • Super-resolution microscopy: Employ structured illumination microscopy or similar techniques to visualize subcellular localization in hair cells

  • In vivo imaging: Use transgenic reporter lines expressing fluorescent-tagged cholesterol sensors together with labeled Minar2 to track dynamic changes in living animals

  • Cross-species comparative studies: Compare phenotypes between zebrafish and mouse models to identify conserved versus divergent functions

Research shows that structured illumination microscopy has been successfully employed to visualize cellular structures in hair cells, making it a valuable tool for studying Minar2 localization and function .

What potential compensatory mechanisms exist when UPF0258 protein KIAA1024-like homolog is absent or mutated?

The investigation of compensatory mechanisms when UPF0258 protein KIAA1024-like homolog (Minar2) is absent requires sophisticated experimental approaches:

  • Transcriptomic analysis: RNA-seq of wild-type versus knockout tissues to identify upregulated genes that may compensate for Minar2 loss

  • Examination of UPF0258 gene family members: Targeted analysis of expression changes in related family members

  • Double/triple knockout studies: Generation of compound mutants lacking multiple potentially compensatory genes

  • Rescue experiments: Reintroduction of Minar2 or related proteins to determine functional overlap

Research indicates that while other genes within the UPF0258 family might be expected to compensate for Minar2 loss, there's evidence suggesting that genes outside this family may also play compensatory roles . The methodological challenge lies in identifying these compensatory mechanisms, particularly given the observation that zebrafish models show less severe phenotypes than mouse models, suggesting species-specific differences in compensation mechanisms.

How can researchers effectively analyze data contradictions in UPF0258 protein KIAA1024-like homolog studies across different model organisms?

When confronted with contradictory data between zebrafish and mouse models of UPF0258 protein KIAA1024-like homolog function, researchers should implement the following methodological approaches:

  • Standardized phenotyping protocols: Develop equivalent assays across model organisms to ensure comparable measurements

  • Detailed molecular characterization: Perform comprehensive analysis of protein expression, localization, and interaction partners in each model organism

  • Evolutionary analysis: Examine the conservation of protein domains and regulatory elements across species

  • Consideration of genetic background effects: Test multiple strains within each species to identify potential modifier genes

  • Meta-analysis approaches: Systematically review all available data with statistical methods to identify patterns in contradictory findings

The observation that zebrafish minar2 mutants show less severe hearing phenotypes than mouse models underscores the importance of considering evolutionary divergence in gene function and regulatory networks when interpreting experimental results across species.

What are the best experimental designs for studying protein-protein interactions involving UPF0258 protein KIAA1024-like homolog?

For investigating protein-protein interactions involving UPF0258 protein KIAA1024-like homolog, researchers should consider these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): Using tagged recombinant Minar2 protein to pull down interaction partners from cellular lysates

  • Proximity labeling methods: BioID or APEX2 tagging of Minar2 to identify proteins in close proximity in living cells

  • Yeast two-hybrid screening: Systematic screening for direct protein interactions

  • Co-immunoprecipitation validation: Confirming key interactions in relevant cell types or tissues

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC): Visualizing interactions in living cells

The experimental design should include appropriate controls for specificity, such as using mutant versions of Minar2 that lack functional domains, and validation in physiologically relevant cell types, particularly inner ear hair cells given Minar2's role in hearing .

What methodological approaches can be used to study the relationship between UPF0258 protein KIAA1024-like homolog and cholesterol in hearing loss models?

To investigate the mechanistic relationship between UPF0258 protein KIAA1024-like homolog and cholesterol in hearing loss, researchers should employ these methodological approaches:

  • Cholesterol modulation experiments: Treat animal models or cell cultures with cholesterol-depleting or -enriching agents to determine effects on Minar2 function

  • Lipid raft isolation: Examine Minar2 localization in membrane microdomains rich in cholesterol

  • Site-directed mutagenesis: Identify and mutate potential cholesterol-binding domains in Minar2

  • Pharmacological manipulation: Use specific inhibitors of cholesterol metabolism to determine pathway-specific effects

  • Advanced imaging: Combine super-resolution microscopy with cholesterol-specific stains to visualize co-localization

Research has shown that Minar2 is essential for hearing by regulating cholesterol levels in the inner ear . A comprehensive approach would combine genetic manipulation of Minar2 with careful monitoring of cholesterol distribution and auditory function measurements.

What are the unexplored aspects of UPF0258 protein KIAA1024-like homolog that warrant further investigation?

Several key areas remain unexplored regarding UPF0258 protein KIAA1024-like homolog:

  • Structural biology: Determination of the three-dimensional structure through X-ray crystallography or cryo-EM

  • Tissue-specific functions: Investigation of Minar2 roles in tissues beyond the inner ear

  • Signaling pathways: Identification of upstream regulators and downstream effectors of Minar2

  • Post-translational modifications: Characterization of potential regulatory modifications

  • Evolution of function: Comparative studies across a broader range of species to understand functional conservation

Methodologically, these investigations would benefit from interdisciplinary approaches combining structural biology, systems biology, and evolutionary biology techniques to build a comprehensive understanding of this protein's biological significance.

How might advanced genetic editing technologies enhance our understanding of UPF0258 protein KIAA1024-like homolog function?

Advanced genetic editing technologies offer powerful new approaches to study UPF0258 protein KIAA1024-like homolog:

  • Base editing and prime editing: Introduction of specific point mutations to study structure-function relationships without complete gene knockout

  • CRISPRi/CRISPRa systems: Modulation of gene expression levels without altering the genetic sequence

  • Cell-type specific Cre-driver lines: Generation of conditional knockouts in specific cell populations

  • Inducible gene regulation: Temporal control of gene expression to study developmental versus maintenance roles

  • In vivo lineage tracing: Combining genetic manipulation with cellular lineage marking to track effects across development

These technologies would allow more nuanced investigation of Minar2 function by avoiding the potential confounding effects of developmental compensation that may occur in traditional knockout models, which may explain some of the contradictory findings between different model organisms .

What statistical approaches are most appropriate for analyzing phenotypic data in UPF0258 protein KIAA1024-like homolog studies?

For robust statistical analysis of phenotypic data in UPF0258 protein studies, researchers should consider:

  • Power analysis: Determine appropriate sample sizes before conducting experiments

  • Mixed-effects modeling: Account for both fixed effects (genotype, treatment) and random effects (litter, experimental batch)

  • Multiple testing correction: Apply FDR or Bonferroni corrections when performing multiple comparisons

  • Non-parametric methods: Use when data do not meet normality assumptions

  • Bayesian approaches: Incorporate prior knowledge when analyzing small sample sizes

When analyzing hearing phenotypes in Minar2 mutant models, it's particularly important to account for age-related changes and potential sex differences, as these may interact with the genetic effects. Meta-analysis approaches can also help reconcile apparently contradictory findings across different studies or model organisms .

How can researchers ensure reproducibility in studies involving recombinant UPF0258 protein KIAA1024-like homolog?

To ensure experimental reproducibility when working with recombinant UPF0258 protein:

  • Detailed reporting of expression constructs: Include complete sequence information, vector maps, and cloning strategies

  • Standardized purification protocols: Document all buffer compositions, column types, and chromatography parameters

  • Quality control metrics: Report protein purity (SDS-PAGE), identity (mass spectrometry), and functionality (activity assays)

  • Storage stability data: Document protein stability under various storage conditions

  • Batch variation analysis: Characterize lot-to-lot variability in protein preparations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.