Recombinant Mouse UPF0414 transmembrane protein C20orf30 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
Tmem230; Transmembrane protein 230
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem230
Target Protein Sequence
MMPSRTNLATGLPSSKVKYSRLASTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGTFLI IIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Uniprot No.

Target Background

Function

Involved in the trafficking and recycling of synaptic vesicles.

Database Links
Protein Families
TMEM134/TMEM230 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Golgi apparatus, trans-Golgi network. Early endosome. Recycling endosome. Late endosome. Cytoplasmic vesicle, autophagosome.
Tissue Specificity
Widely expressed, including dopaminergic neurons in the substantia nigra.

Q&A

How does mouse UPF0414 C20orf30 homolog compare with homologs from other species?

Mouse UPF0414 C20orf30 homolog (UniProt: Q8CIB6) shares significant sequence and structural homology with other mammalian species. Cross-species comparisons reveal evolutionary conservation of this protein family:

SpeciesGene NamesSequence Identity to MouseHost SystemUniProt Identifier
MouseTMEM230, 5730494N06Rik100%Mammalian cellQ8CIB6
BovineTMEM230, C20orf30~85%Cell-free expression-
RatTmem230, RGD1307399~95%E. coli/Yeast-
HumanTMEM230, C20orf30, HSPC274~88%Various-
ChickenRCJMB04_6c24, C22H20ORF30~75%Baculovirus-

The high degree of conservation suggests important biological functions that have been maintained throughout evolution.

What are the recommended storage conditions for recombinant mouse UPF0414 protein?

For optimal stability and activity maintenance, store the recombinant protein at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps maintain stability during freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to prevent protein degradation .

For experimental protocols requiring multiple uses, it is advisable to create single-use aliquots upon initial reconstitution rather than repeatedly freezing and thawing the same stock, as this significantly preserves protein integrity and experimental reproducibility.

What are the optimal conditions for reconstituting lyophilized UPF0414 protein?

When reconstituting lyophilized UPF0414 transmembrane protein C20orf30 homolog:

  • Allow the lyophilized protein to reach room temperature before opening the vial to prevent moisture condensation.

  • Reconstitute in a sterile buffer compatible with your experimental system. For most applications, a Tris-based buffer (pH 7.4-8.0) is recommended.

  • Gently mix by swirling or pipetting—avoid vigorous vortexing which can cause protein denaturation.

  • Allow the solution to sit for 10-15 minutes at room temperature to ensure complete solubilization.

  • For long-term storage, consider adding carrier proteins like BSA (0.1-1%) if not using the carrier-free version.

The reconstituted protein should appear clear without visible precipitates. If precipitation occurs, it may indicate improper reconstitution or protein degradation .

How can I validate the activity of recombinant UPF0414 protein in experimental settings?

Validating recombinant UPF0414 protein activity requires multiple complementary approaches:

  • Structural integrity assessment: Use SDS-PAGE to confirm the expected molecular weight (~13-14 kDa) under reducing conditions. Western blotting with specific antibodies can further validate identity.

  • Functional binding assays: Similar to validation methods used for proteins like recombinant mouse 4-1BB/TNFRSF9, develop a functional ELISA to assess binding capabilities to known interaction partners .

  • Subcellular localization: Perform immunofluorescence studies in transfected cells to confirm proper membrane localization, which is critical for transmembrane protein functionality.

  • Downstream signaling: Monitor activation of known downstream pathways affected by TMEM230, particularly those implicated in neurological function.

For comprehensive validation, compare results with positive controls (commercially validated proteins) and negative controls (buffer-only or irrelevant protein samples).

How is UPF0414/TMEM230 implicated in neurological disorders research?

TMEM230 has emerged as a significant protein in neurological disorder research, particularly in Parkinson's disease pathways. Methodological approaches to study its role include:

  • Vesicular trafficking analysis: TMEM230 localizes to vesicles in neuronal cells. Researchers can use fluorescently tagged TMEM230 constructs to monitor vesicular movement in live-cell imaging.

  • Neurotransmitter release assays: Measure dopamine release in cell culture models with wild-type versus mutant TMEM230 to assess functional impact on neurotransmission.

  • Protein-protein interaction studies: Use co-immunoprecipitation and proximity ligation assays to identify TMEM230 interaction partners in the context of neurodegeneration.

  • Animal model development: Generate transgenic mouse models expressing disease-associated TMEM230 variants to study in vivo effects on neurological function and pathology.

These methodological approaches provide insight into how TMEM230 dysfunction contributes to neurological disease mechanisms, potentially leading to novel therapeutic targets.

What techniques are recommended for studying UPF0414 protein interactions in cancer research contexts?

For investigating UPF0414/TMEM230 protein interactions in cancer research:

  • Proximity-dependent biotin identification (BioID): This technique allows identification of proteins that interact with or are in close proximity to TMEM230 in living cells, revealing cancer-relevant interaction networks.

  • Co-immunoprecipitation coupled with mass spectrometry: This approach identifies stable protein complexes containing TMEM230 in cancer cell lines, potentially revealing novel cancer pathway associations.

  • CRISPR-Cas9 knockout/knockin models: Generate cancer cell lines with TMEM230 modifications to assess effects on proliferation, migration, and drug resistance mechanisms.

  • Phospho-proteomic analysis: Investigate how TMEM230 expression affects signaling pathways by quantifying changes in protein phosphorylation, particularly in epidermal growth factor receptor pathways as suggested by research on triple negative breast cancer .

These methodologies can help elucidate potential roles of TMEM230 in cancer progression and therapy resistance, similar to research conducted on EGFR inhibitor resistance in triple negative breast cancer .

What are common pitfalls when working with recombinant transmembrane proteins like UPF0414?

When working with transmembrane proteins like UPF0414/TMEM230, researchers often encounter several challenges:

  • Protein aggregation: Transmembrane proteins have hydrophobic domains that can cause aggregation in aqueous solutions. To address this:

    • Use mild detergents (0.1% Triton X-100 or 0.5% CHAPS) during extraction

    • Include glycerol (10-20%) in storage buffers

    • Maintain protein at appropriate concentration to prevent concentration-dependent aggregation

  • Functional conformation loss: Transmembrane proteins often lose native conformation during purification. Strategies to mitigate this include:

    • Use of nanodiscs or liposomes to maintain membrane environment

    • Working at physiologically relevant pH (typically 7.2-7.4)

    • Including stabilizing agents like specific lipids in reconstitution buffers

  • Non-specific binding: Transmembrane proteins can exhibit high background in binding assays. Counter this by:

    • Including blocking agents specific to your experimental system

    • Performing more stringent washing steps

    • Using detergent-resistant interaction controls

Documenting these common issues and their solutions contributes to improved experimental reproducibility across research groups working with these challenging proteins.

How can I optimize western blot protocols specifically for UPF0414 transmembrane protein?

Optimizing western blot protocols for UPF0414/TMEM230 transmembrane protein requires several specific considerations:

  • Sample preparation:

    • Heat samples at 37°C instead of boiling to prevent aggregation

    • Use specialized lysis buffers containing 1-2% SDS or NP-40 to efficiently extract membrane proteins

    • Add a reducing agent (β-mercaptoethanol or DTT) to disrupt potential disulfide bonds

  • Gel selection and transfer:

    • Use gradient gels (4-20%) for better resolution of transmembrane proteins

    • Consider specialized transfer buffers with reduced methanol (10% vs. 20%) and added SDS (0.01-0.05%)

    • Extend transfer time while decreasing voltage for improved efficiency

  • Detection optimization:

    • Employ longer blocking times (2-3 hours) with 5% milk or BSA

    • Use primary antibody dilutions at 1:500 to 1:1000 initially, then optimize

    • Consider overnight incubation at 4°C for primary antibodies to improve signal-to-noise ratio

  • Troubleshooting specific issues:

    • For multiple bands: validate with knockout controls or peptide competition assays

    • For weak signals: try membrane activation with methanol prior to transfer

    • For high background: increase washing duration and detergent concentration

These specialized approaches address the unique challenges posed by transmembrane proteins in western blot applications.

How does UPF0414/TMEM230 function compare across different mouse tissue types?

Comparative analysis of UPF0414/TMEM230 expression and function across mouse tissues reveals tissue-specific roles and expression patterns:

  • Neural tissue: Highest expression in neurons, particularly in synaptic regions, correlating with its role in vesicular trafficking. Methodologies for studying neural-specific functions include:

    • Synaptosomes isolation and proteomic analysis

    • Electrophysiological recordings in neuronal cultures

    • In vivo neural circuit imaging in transgenic models

  • Immune cells: Moderate expression with potential roles in vesicle-mediated secretion. Research approaches include:

    • Flow cytometry-based trafficking assays

    • Cytokine release quantification

    • Immune cell activation studies

  • Metabolic tissues (liver, adipose): Lower expression with possible roles in metabolic regulation. Investigative methods:

    • Metabolomic profiling

    • Glucose uptake assays

    • Lipidomic analysis

This tissue-specific comparative approach provides insight into the diverse functions of TMEM230 beyond its established neurological roles, potentially revealing new therapeutic targets across multiple disease states.

What are cutting-edge approaches for studying the role of UPF0414/TMEM230 in protein trafficking?

Advanced methodologies for investigating UPF0414/TMEM230's role in protein trafficking include:

  • Live-cell super-resolution microscopy:

    • PALM/STORM imaging allows tracking of single TMEM230 molecules with ~20nm resolution

    • Dual-color imaging can visualize co-trafficking with cargo proteins

    • Quantitative analysis of trafficking dynamics using particle tracking algorithms

  • Proximity-dependent labeling combined with proteomics:

    • TurboID or APEX2 fusion proteins to identify proximal proteins in specific cellular compartments

    • Temporal analysis of the TMEM230 interactome during trafficking events

    • Comparative analysis between wild-type and disease-associated variants

  • Organelle-specific isolation and proteomics:

    • Vesicle immunoisolation using TMEM230 antibodies followed by mass spectrometry

    • Subcellular fractionation to analyze compartment-specific TMEM230 complexes

    • Comparative glycoproteomics to identify trafficking-dependent modifications

  • CRISPR-based screening approaches:

    • Genome-wide CRISPR screens to identify genes that synthetic lethal with TMEM230

    • CRISPRi/CRISPRa to modulate TMEM230 expression and identify dosage-sensitive pathways

    • Base editing to introduce specific disease-associated mutations

These cutting-edge approaches provide unprecedented insight into the molecular mechanisms underlying TMEM230's role in cellular trafficking processes and how disruptions contribute to disease pathogenesis.

What emerging research questions remain unanswered about UPF0414/TMEM230?

Despite significant advances in understanding UPF0414/TMEM230, several critical research questions remain unexplored:

  • Structure-function relationships: The detailed three-dimensional structure of TMEM230 remains unresolved. Advanced approaches like cryo-EM or X-ray crystallography of the purified protein in membrane mimetics could reveal crucial structural insights.

  • Post-translational modification landscape: Comprehensive characterization of phosphorylation, glycosylation, and other modifications that regulate TMEM230 function is needed, particularly in disease contexts.

  • Evolutionary dynamics: While sequence conservation is established across species, the functional divergence or conservation of TMEM230 across evolutionary timescales requires systematic investigation.

  • Interactome in health and disease: Differential interactome analysis between normal and pathological conditions could reveal dysregulated protein-protein interactions contributing to disease mechanisms.

  • Therapeutic targeting potential: Development of methods to specifically modulate TMEM230 activity or expression represents an untapped opportunity for therapeutic intervention in associated diseases.

Addressing these questions will require interdisciplinary approaches combining structural biology, systems biology, and translational research methodologies.

How might recombinant UPF0414/TMEM230 be utilized in developing novel research models?

Recombinant UPF0414/TMEM230 offers multiple opportunities for developing innovative research models:

  • Protein-based biosensors: Engineer TMEM230 fusion constructs with fluorescent or bioluminescent reporters to monitor membrane dynamics or protein trafficking in real-time.

  • Organoid development: Supplement brain organoid cultures with recombinant TMEM230 to study uptake and effects on neural development and function.

  • Biomaterial functionalization: Incorporate TMEM230 into synthetic membranes or nanoparticles to create biomimetic systems for studying membrane protein function.

  • High-throughput screening platforms: Develop TMEM230-based assays to screen for compounds that modulate its function or interaction with disease-relevant partners.

  • In vitro reconstitution systems: Create synthetic vesicles containing purified TMEM230 to study its intrinsic properties in a controlled environment.

These innovative applications of recombinant TMEM230 could significantly advance our understanding of its biology while creating new tools for broader research applications in neuroscience and cell biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.