Recombinant Mouse UPF0458 protein C7orf42 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Tmem248; Transmembrane protein 248
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem248
Target Protein Sequence
MFSINPLENLKLYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL RFNDLDLCVSENETLKHLSNDTTTPESTMTVGQARSSTQPPQSLEESGPINISVAITLTL DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAHEEINITFTLPAAWNADDCALHGHCEQA VFTACMTLTAAPGVFPVTVQPPHCIPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK GAIGKVYHALNPKLTVVVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS NPEFCPEKVALADA
Uniprot No.

Target Background

Database Links
Protein Families
TMEM248 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0458 protein C7orf42 homolog and what are its known functions?

UPF0458 protein C7orf42 homolog belongs to the transmembrane protein family, similar to the rat homolog which is also known as Tmem248 (transmembrane protein 248) . While specific functions of the mouse homolog remain under investigation, structural analysis suggests it contains transmembrane domains characteristic of membrane proteins involved in cellular signaling or transport mechanisms. The protein exhibits a complex amino acid sequence with multiple hydrophobic regions, suggesting multiple membrane-spanning segments . Current research indicates potential roles in cellular homeostasis and membrane organization, though functional studies are ongoing.

What expression systems are most effective for producing recombinant mouse UPF0458 protein C7orf42 homolog?

Expression SystemAdvantagesLimitationsRecommended Strain/Cell Line
E. coliCost-effective, high yield, rapid growthLimited post-translational modificationsBL21(DE3)
MammalianNative-like post-translational modificationsHigher cost, lower yieldHEK293, CHO cells
InsectIntermediate cost, good for eukaryotic proteinsModerate yieldSf9, High Five

How is recombinant mouse UPF0458 protein C7orf42 homolog typically purified?

Purification typically employs affinity chromatography, utilizing tags such as His-tag fusion constructs similar to those used for the rat homolog . A standard purification protocol involves:

  • Cell lysis in buffer containing mild detergents to solubilize membrane proteins

  • Initial clarification by centrifugation at 12,000-15,000 g

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Wash steps with increasing imidazole concentrations to reduce non-specific binding

  • Elution with high imidazole buffer

  • Size exclusion chromatography for final polishing

For insoluble protein aggregates forming inclusion bodies, inclusion body isolation followed by solubilization in denaturing agents (like 8M urea or 6M guanidine hydrochloride) and subsequent refolding may be necessary . Buffers containing 2% sarkosyl have shown effectiveness in purifying other complex recombinant proteins and may be applicable here .

What are typical storage conditions for maintaining stability of recombinant mouse UPF0458 protein C7orf42 homolog?

Optimal storage conditions generally follow those established for similar recombinant proteins. Lyophilization preserves long-term stability, with storage at -20°C/-80°C recommended for extended periods . For working solutions, aliquoting prevents repeated freeze-thaw cycles that compromise protein integrity. Based on similar protein handling protocols:

Storage FormTemperatureBuffer CompositionAdditivesDuration
Lyophilized-20°C to -80°CTris/PBS-based, pH 8.06% Trehalose12+ months
Solution4°CPBS pH 7.4None1 week
Solution-20°C to -80°CPBS with glycerol5-50% glycerol6+ months

Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

What methods are used to verify identity and purity of recombinant mouse UPF0458 protein C7orf42 homolog?

Multiple analytical techniques ensure proper identity and purity verification:

  • SDS-PAGE analysis confirms molecular weight and initial purity assessment, with expected purity >90%

  • Western blotting using anti-His antibodies or specific antibodies against the protein confirms identity

  • Mass spectrometry (MS) provides precise molecular weight determination and sequence verification

  • Circular dichroism (CD) spectroscopy assesses proper secondary structure formation

  • Size exclusion chromatography analyzes aggregation state and homogeneity

For transmembrane proteins, additional detergent screening may be necessary to maintain native-like conformations during analysis .

What are optimal conditions for solubilizing and refolding recombinant mouse UPF0458 protein C7orf42 homolog from inclusion bodies?

Solubilization and refolding of transmembrane proteins like UPF0458 protein C7orf42 homolog from inclusion bodies requires careful optimization. Based on successful approaches with similar proteins:

  • Solubilization typically employs strong denaturants:

    • 8M urea or 6M guanidine hydrochloride in Tris buffer (pH 8.0)

    • Addition of reducing agents (5-10 mM DTT or 2-mercaptoethanol)

    • Buffer containing 2% sarkosyl has shown effectiveness for similar proteins

  • Refolding strategies include:

    • Rapid dilution into refolding buffer containing mild detergents (0.1-1% DDM, LDAO)

    • Step-wise dialysis with gradually decreasing denaturant concentration

    • On-column refolding during affinity purification

  • Critical parameters for optimization:

    • Protein concentration during refolding (typically 0.1-0.5 mg/mL)

    • Temperature (4-25°C)

    • Presence of stabilizing agents (glycerol, arginine, sucrose)

Experimental validation of proper refolding should include functional assays and structural characterization techniques like CD spectroscopy.

How can buffer composition be optimized to enhance stability of recombinant mouse UPF0458 protein C7orf42 homolog?

Buffer optimization is critical for maintaining stability of transmembrane proteins. A systematic approach includes:

  • pH screening (typically pH 6.0-9.0 in 0.5 unit increments)

  • Salt concentration optimization (NaCl at 50-500 mM)

  • Addition of stabilizing agents:

    • Glycerol (5-50%)

    • Trehalose (2-10%)

    • Arginine (50-500 mM)

    • Sucrose (5-20%)

  • Detergent screening for membrane proteins:

    • DDM (0.02-0.1%)

    • LDAO (0.05-0.2%)

    • Digitonin (0.1-0.5%)

  • Antioxidants for proteins with critical cysteine residues:

    • DTT (1-5 mM)

    • TCEP (0.5-2 mM)

Buffer optimization should be evaluated through thermal shift assays, dynamic light scattering, and activity/binding assays over time at various temperatures.

What structural characterization techniques provide the most valuable insights for recombinant mouse UPF0458 protein C7orf42 homolog?

Multiple complementary structural techniques offer valuable insights:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides secondary structure composition (α-helices, β-sheets)

    • Monitors thermal stability and unfolding transitions

    • Assesses structural changes upon ligand binding

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Offers residue-specific structural information in solution

    • Particularly valuable for transmembrane domains in micelles

    • Identifies dynamic regions and ligand-binding interfaces

  • X-ray Crystallography:

    • Provides high-resolution three-dimensional structure

    • Challenging for membrane proteins but possible with crystallization screening

    • May require lipidic cubic phase methods for membrane proteins

  • Cryo-Electron Microscopy:

    • Increasingly powerful for membrane protein structures

    • Requires minimal sample amount compared to crystallography

    • Can capture multiple conformational states

  • Small-Angle X-ray Scattering (SAXS):

    • Provides low-resolution structural envelope in solution

    • Useful for assessing oligomeric state and conformational changes

The integration of multiple techniques provides the most comprehensive structural understanding.

How can functional activity of recombinant mouse UPF0458 protein C7orf42 homolog be evaluated?

In the absence of well-characterized specific functions, several approaches can assess functional integrity:

  • Protein-Protein Interaction Assays:

    • Pull-down assays with potential interacting partners

    • Surface plasmon resonance (SPR) for binding kinetics

    • Biolayer interferometry for real-time interaction analysis

  • Membrane Incorporation Assessment:

    • Liposome reconstitution studies

    • Fluorescence-based membrane integration assays

    • Proteoliposome formation and characterization

  • Cellular Assays:

    • Transfection/transduction studies with tagged protein

    • Subcellular localization analysis

    • Rescue experiments in knockout models

  • Biophysical Characterization:

    • Thermal stability assays to measure proper folding

    • Oligomerization state analysis (SEC-MALS, analytical ultracentrifugation)

    • Ligand binding studies if potential ligands are identified

Functional assays should be designed based on bioinformatic predictions of protein function and established assays for related proteins.

What experimental approaches are most effective for investigating the physiological role of UPF0458 protein C7orf42 homolog in mouse models?

Comprehensive investigation of physiological roles requires multiple complementary approaches:

  • CRISPR-Cas9 Gene Editing:

    • Generation of knockout mouse models

    • Creation of conditional knockout models for tissue-specific studies

    • Introduction of tagged versions for localization studies

  • Tissue Expression Profiling:

    • qRT-PCR analysis across tissues and developmental stages

    • Immunohistochemistry with specific antibodies

    • Single-cell RNA sequencing for cell-type specific expression

  • Interactome Analysis:

    • Immunoprecipitation coupled with mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • Yeast two-hybrid screening with domain-specific constructs

  • Functional Genomics:

    • RNA-seq analysis in knockout versus wild-type tissues

    • Proteomics comparison of membrane fractions

    • Metabolomics to identify pathway alterations

  • Phenotypic Characterization:

    • Comprehensive phenotyping of knockout models

    • Tissue-specific functional assays based on expression pattern

    • Physiological challenges to reveal conditional phenotypes

Integration of these approaches provides a comprehensive understanding of protein function in physiological contexts.

What strategies can overcome low expression yields of recombinant mouse UPF0458 protein C7orf42 homolog?

Low expression yields present a common challenge for transmembrane proteins. Effective strategies include:

  • Expression System Optimization:

    • Testing multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Evaluating different growth media (TB, 2xYT, auto-induction)

    • Optimizing induction parameters:

      • IPTG concentration (0.1-1.0 mM)

      • Induction temperature (15-37°C)

      • Induction duration (4-24 hours)

  • Construct Optimization:

    • Codon optimization for expression host

    • Testing different fusion tags (His, GST, MBP)

    • Domain truncation to remove aggregation-prone regions

  • Co-expression with Chaperones:

    • GroEL/GroES system

    • DnaK/DnaJ/GrpE system

    • Specific membrane protein chaperones

Based on optimization studies with other recombinant proteins, expression at lower temperatures (15°C) for extended periods (24 hours) with moderate IPTG concentration (0.25 mM) in rich media like TB may yield optimal results .

How can non-specific binding be minimized during affinity purification of recombinant mouse UPF0458 protein C7orf42 homolog?

Non-specific binding during affinity purification can compromise purity. Effective minimization strategies include:

  • Optimization of Binding Conditions:

    • Increased salt concentration in binding buffer (300-500 mM NaCl)

    • Addition of low imidazole (10-20 mM) in binding buffer

    • Incorporation of mild detergents (0.1% Triton X-100 or Tween-20)

  • Wash Optimization:

    • Step-wise imidazole gradient (20, 40, 60 mM)

    • Increased wash volume (10-20 column volumes)

    • Addition of arginine (50-100 mM) to reduce hydrophobic interactions

  • Resin Selection:

    • Comparison of different IMAC resins (Ni-NTA, Co-TALON, Ni-IDA)

    • Consideration of alternative affinity tags (Strep-tag, FLAG-tag)

    • Evaluation of resin capacity and flow rate

  • Two-step Purification Strategy:

    • IMAC followed by ion exchange chromatography

    • IMAC followed by size exclusion chromatography

    • Consideration of on-column detergent exchange during purification

These approaches should be systematically evaluated to determine optimal conditions for each specific preparation.

What analytical methods best detect contaminants in purified recombinant mouse UPF0458 protein C7orf42 homolog preparations?

Comprehensive contaminant detection requires multiple complementary techniques:

  • Protein-based Contaminant Detection:

    • High-resolution SDS-PAGE with silver staining (detection limit ~1 ng)

    • 2D gel electrophoresis for closely related contaminants

    • Western blotting with anti-His and host cell protein antibodies

    • Mass spectrometry-based proteomics for trace contaminant identification

  • Nucleic Acid Contaminant Detection:

    • UV absorbance ratio (A260/A280) measurement

    • Ethidium bromide-stained agarose gel electrophoresis

    • Quant-iT PicoGreen assay for sensitive DNA detection

  • Endotoxin Contamination:

    • Limulus Amebocyte Lysate (LAL) assay

    • Recombinant Factor C assay

    • EndoZyme recombinant endotoxin detection

  • Aggregation Assessment:

    • Dynamic light scattering (DLS)

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation

Purity assessment should aim for >90% as determined by SDS-PAGE and absence of detectable endotoxin for downstream applications .

How can recombinant mouse UPF0458 protein C7orf42 homolog be used to generate specific antibodies for research applications?

Generation of specific antibodies requires strategic immunization approaches:

  • Antigen Preparation Strategies:

    • Full-length protein immunization requires proper folding and stability

    • Immunogenic peptide selection from hydrophilic, surface-exposed regions

    • Multiple antigen peptide (MAP) system for enhanced immunogenicity

    • Consideration of fusion with carrier proteins (KLH, BSA)

  • Immunization Protocol Optimization:

    • Selection of appropriate adjuvant (Freund's, alum-based, synthetic)

    • Prime-boost strategy with 2-3 week intervals

    • Route optimization (subcutaneous, intraperitoneal)

    • Species selection (rabbit, goat, mouse) based on application needs

  • Antibody Purification and Characterization:

    • Affinity purification against recombinant protein

    • Validation by Western blot, ELISA, and immunoprecipitation

    • Cross-reactivity testing against related proteins

    • Application-specific validation (IHC, IF, flow cytometry)

The addition of immunostimulatory peptides to constructs has been shown to enhance humoral immune responses, resulting in higher antibody titers as demonstrated with other mouse recombinant proteins .

What approaches can identify potential binding partners of recombinant mouse UPF0458 protein C7orf42 homolog?

Identification of binding partners requires systematic interaction screening:

  • Affinity-based Methods:

    • Pull-down assays with tagged recombinant protein

    • Co-immunoprecipitation from tissue lysates

    • Surface plasmon resonance screening

    • Protein arrays for systematic interaction testing

  • Proximity-based Approaches:

    • BioID proximity labeling in cellular systems

    • APEX2 enzymatic proximity labeling

    • Cross-linking mass spectrometry (XL-MS)

  • Genetic and Cellular Screens:

    • Yeast two-hybrid screening

    • Mammalian two-hybrid assays

    • CRISPR-based genetic interaction screens

    • Fluorescence resonance energy transfer (FRET) assays

  • Computational Prediction and Validation:

    • Protein-protein interaction network analysis

    • Domain-based interaction prediction

    • Molecular docking simulations

    • Evolutionary conservation of interaction interfaces

Validation of identified interactions should include reciprocal co-immunoprecipitation and functional characterization in cellular contexts.

What considerations are important when designing site-directed mutagenesis studies for recombinant mouse UPF0458 protein C7orf42 homolog?

Effective site-directed mutagenesis requires strategic planning:

  • Target Selection Strategy:

    • Evolutionary conservation analysis to identify functionally important residues

    • Secondary structure prediction to target surface-exposed regions

    • Transmembrane domain mapping to preserve membrane topology

    • Post-translational modification site identification

  • Mutation Design Principles:

    • Conservative substitutions to assess specific interactions

    • Charge reversal to disrupt electrostatic interactions

    • Alanine scanning of functional domains

    • Cysteine introduction for disulfide mapping and accessibility studies

  • Technical Considerations:

    • PCR-based mutagenesis methods (QuikChange, Q5 site-directed mutagenesis)

    • Primer design optimization for efficient mutagenesis

    • Sequence verification of the entire coding region

    • Expression and folding assessment of mutant proteins

  • Functional Impact Analysis:

    • Comparative biochemical characterization (stability, binding)

    • Structural analysis of wild-type versus mutant proteins

    • Cellular localization and trafficking assessment

    • Integration with in vivo models for physiological relevance

Systematic mutagenesis approaches provide valuable structure-function relationships that inform biological mechanisms.

How is recombinant mouse UPF0458 protein C7orf42 homolog being used in current mouse model systems?

Current applications in mouse model systems focus on several research areas:

  • Expression Pattern Analysis:

    • Tissue-specific expression profiling across developmental stages

    • Cell-type specific localization in complex tissues

    • Response to physiological and pathological stimuli

  • Functional Genomics Approaches:

    • Generation and characterization of knockout and knockin models

    • Conditional knockout models for tissue-specific studies

    • CRISPR/Cas9-mediated tagging for live visualization

  • Interactome Mapping:

    • In vivo proximity labeling approaches

    • Tissue-specific pull-down experiments

    • Cross-linking mass spectrometry in native tissues

  • Disease Model Applications:

    • Expression analysis in disease models

    • Assessment of potential contributions to pathophysiological processes

    • Evaluation as potential biomarker or therapeutic target

Integration with other omics approaches provides comprehensive understanding of protein function in physiological contexts.

What quality control parameters should be assessed for batches of recombinant mouse UPF0458 protein C7orf42 homolog?

Comprehensive quality control ensures reproducible experimental results:

  • Identity Verification:

    • Mass spectrometry confirmation of molecular weight

    • N-terminal sequencing for sequence verification

    • Immunological detection with specific antibodies

  • Purity Assessment:

    • SDS-PAGE analysis with target purity >90%

    • Size exclusion chromatography for aggregation analysis

    • Host cell protein quantification by ELISA

  • Functional Characterization:

    • Secondary structure analysis by circular dichroism

    • Thermal stability assessment by differential scanning fluorimetry

    • Binding activity evaluation if ligands are known

  • Contaminant Testing:

    • Endotoxin testing with acceptance criteria <1.0 EU per μg

    • Nucleic acid contamination assessment

    • Bioburden testing for sterility

  • Stability Monitoring:

    • Accelerated stability studies at elevated temperatures

    • Real-time stability monitoring at storage conditions

    • Freeze-thaw cycle stability testing

Batch-to-batch consistency should be documented through certificates of analysis containing these parameters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.