Recombinant Mouse UPF0668 protein C10orf76 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its use.
Synonyms
Armh3; Armadillo-like helical domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-689
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MAQVEKRGGLLRKSSASKKPLKEKVVLMYDEIFMTEDPSKCSPRFWEELFLMKVNLEYLE GKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSG FDIINMLMGFDKAELCMKNLMESLDSLLCAEGSESLKSLCLKLLLCLVTVTDNISQNTIL EYVMINSIFEAILQILSHPPSRREHGYDAVVLLALLVNYRKYESVNPYIVKLSIVDDEAT LNGMGLVITQALSEYNRQYKDKEEEHQSGFFSALTNMVGSMFIADAHEKLSVQTNEAILL ALYEAVHLNRNFITVLAQSHPEMGLVTAPASPTPTTPATPLGTTPPSSDVISSVELSLDA DVQTSNLLITFLKYSSIVMQDTKDEHRLHSGKLCLIILTCIAEDQYANAFLHDDNMNFRV NLHRMPMRHRKKAADKNLPCRPLVCAVLDLMVEFIVTHMMKEFPMDLYLRCVQVVHKLLC YQKKCRVRLHYTWRELWSALINLLKFLMSNETVLLAKHNIFTLALMIVNLFNMFITYGDT FLPTPSSYDELYYEIIRMHQSFDNLYSMVLRLSTNAGQWKEAASKVTHALVNIRAIINHF NPKIESYAAVNHISQLSEEQVLEVVRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELV RSISTNVRRNLAFHTLSQEALLKEFSTIS
Uniprot No.

Target Background

Function
Involved in GBF1 recruitment, Golgi maintenance, and protein secretion.
Database Links

KEGG: mmu:71617

UniGene: Mm.210949

Protein Families
UPF0668 family
Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasm.

Q&A

How conserved is the UPF0668 protein C10orf76 homolog across species?

The UPF0668 protein C10orf76 homolog is highly conserved across species, suggesting important functional roles that have been maintained throughout evolution. The mouse homolog is also known as ARMH3 (Armadillo-like) . Conservation analysis indicates that homozygous mutants of ARMH3 in mice are lethal at the pre-weaning stage, further emphasizing its evolutionary and developmental significance .

Methodologically, researchers can assess conservation through:

  • Multiple sequence alignments using tools like Clustal Omega or MUSCLE

  • Phylogenetic analysis to determine evolutionary relationships

  • Domain conservation analysis using protein family databases

What are the recommended storage and reconstitution protocols for recombinant UPF0668 protein?

For optimal stability and activity, Recombinant Mouse UPF0668 protein C10orf76 homolog requires specific handling:

Storage ConditionRecommendation
Long-term storage-20°C/-80°C, aliquoted to prevent freeze-thaw cycles
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% recommended)
Working aliquotsStore at 4°C for up to one week

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity. Before opening, the vial should be briefly centrifuged to bring contents to the bottom .

What expression systems are optimal for producing functional Recombinant Mouse UPF0668 protein?

While E. coli is commonly used for expressing Recombinant Mouse UPF0668 protein C10orf76 homolog , researchers should consider multiple expression systems depending on their experimental requirements:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid growthLimited post-translational modificationsBasic structural studies, antibody production
Baculovirus/Sf9Eukaryotic post-translational modifications, high expressionMore complex setup, longer production timeFunctional studies requiring proper folding
Mammalian cellsNative-like modifications, proper foldingLower yield, expensive, time-consumingInteraction studies, functional assays

For specific interaction studies with binding partners like PI4KB, baculovirus and Sf9 expression systems have proven effective. Research has shown that using this system for both UPF0668 protein C10orf76 homolog and PI4KB enables successful purification of proteins that maintain their binding capacity in vitro .

How can researchers optimize purification protocols for Recombinant Mouse UPF0668 protein?

Optimization of purification protocols can be systematically approached using Design of Experiments (DoE) methodology. This approach allows researchers to identify critical parameters affecting protein yield and purity while minimizing the number of experiments required:

  • Identify critical variables (pH, salt concentration, imidazole gradient, temperature)

  • Design a factorial experiment testing these variables at different levels

  • Analyze results to determine optimal conditions

  • Validate optimized protocol with scaled-up purification

For His-tagged UPF0668 protein, a typical optimization would include:

ParameterRange to TestRecommended Starting Point
Lysis buffer pH7.0-8.58.0
NaCl concentration100-500 mM300 mM
Imidazole in wash buffer10-50 mM20 mM
Imidazole in elution buffer250-500 mM300 mM
Flow rate0.5-2 mL/min1 mL/min

When scaling up for larger production, consider simplifying the process by removing unnecessary steps and replacing size exclusion chromatography with alternative methods that are more amenable to scale-up .

How does UPF0668 protein C10orf76 homolog interact with PI4KB, and what methods best capture this interaction?

The UPF0668 protein C10orf76 homolog forms a direct, high-affinity complex with PI4KB. This interaction has been established through several complementary techniques:

  • His-pulldown assays: Using NiNTA-agarose beads and purified recombinant proteins, researchers have demonstrated direct interaction between PI4KB and His-tagged c10orf76 .

  • Co-immunoprecipitation: This technique captures protein complexes from cell lysates and has been used to identify c10orf76 as a putative PI4KB-binding partner .

  • In vitro binding assays: These assays with purified components help determine binding affinity and specificity.

To accurately quantify this interaction, researchers should employ:

  • Surface Plasmon Resonance (SPR) for kinetic measurements

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Fluorescence-based assays for real-time monitoring of complex formation

Experimental design should include appropriate controls such as other PI4KB-binding partners (e.g., Rab11) to determine binding specificity and competitive interactions .

What are the functional consequences of c10orf76-PI4KB complex formation at the Golgi?

The formation of the c10orf76-PI4KB complex has significant implications for Golgi function and lipid metabolism. Specifically, this complex:

  • Regulates Arf1 activation at the Golgi membrane

  • Maintains appropriate PI4P levels at the Golgi

  • Influences PI4KB localization and activity

Paradoxically, research has shown that loss of c10orf76 leads to increased PI4P levels in cells but decreased catalytic activity of PI4KB in vitro . This contradiction suggests the involvement of additional factors in vivo that are not present in simplified in vitro systems.

Methodologically, researchers investigating this phenomenon should:

  • Use both cellular and in vitro reconstitution approaches

  • Employ CRISPR-Cas9 knockout cells alongside recombinant protein studies

  • Perform lipid kinase assays under varying conditions to identify missing cofactors

  • Utilize liposome-based assays to mimic membrane environments

How can researchers address the paradoxical findings regarding c10orf76's effects on PI4P levels?

The paradox that loss of c10orf76 leads to increased PI4P levels in cells yet decreased catalytic activity of PI4KB in vitro requires systematic investigation:

ApproachMethodologyExpected Outcome
Identify missing cellular factorsMass spectrometry of c10orf76 immunoprecipitatesAdditional interacting proteins
Lipid substrate accessibilityLiposome-based assays with varying lipid compositionsEffect of membrane composition on activity
Regulatory modificationsPhosphorylation site mapping and mutational analysisPost-translational regulation mechanisms
Spatiotemporal regulationLive-cell imaging with fluorescent sensorsDynamic changes in PI4P and protein localization

Researchers should design experiments that bridge the gap between in vitro biochemistry and cellular physiology by:

  • Reconstituting minimal systems with defined components

  • Systematically adding cellular factors to identify those that resolve the paradox

  • Using structure-function analyses to define regulatory domains

  • Comparing acute vs. chronic loss of c10orf76 to distinguish direct vs. compensatory effects

What structural domains of UPF0668 protein C10orf76 homolog are critical for its function, and how can they be experimentally determined?

Understanding the structure-function relationship of UPF0668 protein requires domain mapping and structural studies:

  • Truncation analyses: Generate series of N-terminal and C-terminal truncations to map minimal binding domains

  • Point mutations: Target conserved residues for site-directed mutagenesis

  • Structural biology approaches:

    • X-ray crystallography of isolated domains or full-length protein

    • Cryo-EM for larger complexes, especially with PI4KB

    • NMR for dynamics and smaller domains

The presence of an Armadillo-like domain (hence the alternative name ARMH3) suggests potential scaffolding functions that should be specifically investigated .

How does UPF0668 protein C10orf76 homolog contribute to cellular pathways beyond PI4KB regulation?

Given the lethal phenotype of homozygous ARMH3 mutants in mice , the protein likely has broader functions beyond PI4KB regulation. Researchers should employ:

  • Transcriptomics/proteomics: RNA-seq and mass spectrometry on knockout vs. wild-type cells

  • Proximity labeling: BioID or APEX2 fusions to identify neighboring proteins

  • Cellular phenotyping: Assessing multiple cellular processes in knockout/knockdown models

Emerging evidence suggests potential roles in:

  • Golgi structure maintenance

  • Membrane trafficking

  • Protein sorting

  • Cell signaling pathways

What techniques can researchers employ to study the dynamics of UPF0668 protein C10orf76 homolog in living cells?

Advanced imaging techniques offer powerful approaches to study protein dynamics:

TechniqueApplicationAdvantages
FRAP (Fluorescence Recovery After Photobleaching)Protein mobilityMeasures diffusion rates and bound/free fractions
FRET (Förster Resonance Energy Transfer)Protein-protein interactionsReal-time detection of molecular proximity
OptogeneticsAcute protein inactivationTemporal control of protein function
Live-cell super-resolution microscopySubcellular localizationNanoscale resolution of protein distribution

When designing these experiments, researchers should:

  • Create fluorescent protein fusions that preserve native function

  • Validate constructs by rescue experiments in knockout cells

  • Consider both N-terminal and C-terminal tags to avoid disrupting functional domains

  • Use appropriate controls to distinguish specific from non-specific effects

How can cross-species comparisons of UPF0668 protein C10orf76 homologs inform functional studies?

Evolutionary analysis provides valuable insights into protein function:

  • Identify highly conserved regions across species (human, mouse, other mammals, and non-mammalian vertebrates)

  • Map conservation onto predicted structural domains

  • Correlate evolutionary conservation with known functional data

This approach can guide:

  • Selection of critical residues for mutagenesis

  • Identification of species-specific functions

  • Translation of findings between model organisms and humans

What are the most promising approaches to determine if UPF0668 protein C10orf76 homolog has therapeutic relevance?

While direct commercial applications fall outside this academic focus, understanding disease relevance requires:

  • Disease association studies:

    • Analysis of gene expression in disease states

    • Examination of genetic variants in human populations

    • Correlations with Golgi/membrane trafficking disorders

  • Pathway analysis:

    • Integration with known disease pathways

    • Systems biology approaches to place the protein in broader networks

    • Computational prediction of drug-protein interactions

  • Model systems:

    • Conditional knockout mouse models to overcome embryonic lethality

    • Patient-derived cells with relevant mutations

    • Organoid models to study tissue-specific functions

What are the critical quality control steps for ensuring recombinant UPF0668 protein activity?

Ensuring protein quality requires multiple analytical approaches:

Quality ParameterAnalytical MethodAcceptance Criteria
PuritySDS-PAGE>90% purity
IdentityWestern blot, Mass spectrometryCorrect molecular weight, peptide mapping
Structural integrityCircular dichroismProper secondary structure content
Functional activityPI4KB binding assaySpecific binding with expected affinity
Aggregation stateSize exclusion chromatographyPredominantly monomeric or expected oligomeric state

Researchers should implement these quality controls at multiple stages of their experimental workflow to ensure reliable and reproducible results.

How can researchers optimize experimental design when studying UPF0668 protein interactions and function?

Proper experimental design is critical for meaningful results:

  • Use Design of Experiments (DoE) approach:

    • Systematically vary multiple parameters simultaneously

    • Identify interactions between experimental variables

    • Reduce the number of experiments needed to optimize conditions

  • Include appropriate controls:

    • Positive controls (known interacting proteins)

    • Negative controls (non-interacting proteins)

    • Vehicle controls for all reagents

  • Validate findings with complementary methods:

    • Biochemical approaches (pull-downs, activity assays)

    • Cellular approaches (localization, knockout phenotypes)

    • Structural approaches (binding interface mapping)

By implementing these methodological considerations, researchers can enhance the reliability of their findings and advance our understanding of this important protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.