Recombinant Mouse UPF0697 protein C8orf40 homolog

What is Mouse UPF0697 protein C8orf40 homolog?

Mouse UPF0697 protein C8orf40 homolog, also known as Smim19 (Small integral membrane protein 19), is a 107-amino acid protein with a molecular weight of approximately 31 kDa. It is the mouse ortholog of the human C8orf40 protein. The protein is characterized by its small size and membrane-associated properties. While its specific function remains under investigation, structural analysis suggests it contains membrane-spanning domains that may be critical for its biological activity .

What is the amino acid sequence of Mouse UPF0697 protein C8orf40 homolog?

The full amino acid sequence of Mouse UPF0697 protein C8orf40 homolog (UniProt ID: Q80ZU4) is:

MAGSYGVMADDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRKIMRIFSVPPTEGMLSEPSFYDTVSRIRLRQQVEAHPVSRKYEYQQPQSQADSVQLSLE

This 107-amino acid sequence contains regions predicted to form transmembrane domains, which are essential for its localization and potentially for its function in cellular processes.

How should recombinant Mouse UPF0697 protein be stored for optimal stability?

For optimal stability, the recombinant protein should be stored according to these recommendations:

• Long-term storage: -20°C to -80°C

• Working aliquots: 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity

• Store in appropriate buffer conditions (typically Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

For lyophilized preparations, proper reconstitution is critical before storage, and addition of stabilizers such as glycerol (recommended at 5-50% final concentration) can help maintain protein integrity during freezing .

What is the recommended protocol for reconstituting lyophilized Mouse UPF0697 protein?

For optimal reconstitution of lyophilized Mouse UPF0697 protein C8orf40 homolog, follow this protocol:

• Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• For storage stability, add glycerol to a final concentration of 5-50% (50% is typically recommended)

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• For long-term storage, keep aliquots at -20°C or -80°C

This method ensures proper solubilization while maintaining protein stability and activity for downstream applications.

How can researchers validate the purity and integrity of recombinant Mouse UPF0697 protein?

To validate the purity and integrity of recombinant Mouse UPF0697 protein C8orf40 homolog:

• SDS-PAGE analysis: Commercial preparations typically show >90% purity by SDS-PAGE. Run the protein alongside molecular weight markers to confirm the expected size of approximately 31 kDa (or higher if tagged) .

• Western blot analysis: Use antibodies specific to Mouse UPF0697 protein or to the tag (e.g., His-tag) if present.

• Mass spectrometry: For precise molecular weight determination and to confirm protein identity.

• Circular dichroism (CD): To assess secondary structure integrity.

• Dynamic light scattering (DLS): To evaluate protein homogeneity and detect aggregation.

It's advisable to perform multiple validation methods to ensure both purity and proper folding before experimental use.

How do different tags affect the function of Mouse UPF0697 protein in experimental systems?

The impact of protein tags on Mouse UPF0697 protein C8orf40 homolog function requires careful consideration:

What purification strategies are most effective for tagged Mouse UPF0697 protein?

For His-tagged Mouse UPF0697 protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides an efficient single-step purification method. The purification protocol should include:

• Cell lysis under native or denaturing conditions depending on protein solubility

• Equilibration of affinity resin with appropriate buffer

• Binding of the His-tagged protein to the resin

• Washing steps with increasing imidazole concentrations to remove non-specific binding

• Elution with high imidazole concentration buffer

• Buffer exchange to remove imidazole

For membrane proteins like Smim19, inclusion of mild detergents during purification may be necessary to maintain protein solubility while preserving native structure. The specific detergent should be empirically determined based on downstream applications .

What are the known or predicted functions of Mouse UPF0697 protein C8orf40 homolog?

The specific functions of Mouse UPF0697 protein C8orf40 homolog (Smim19) remain under investigation. Based on structural predictions and homology studies:

• Its transmembrane domains suggest potential roles in membrane organization or signaling

• The protein may function in protein-protein interactions within membrane complexes

• Sequence conservation across species indicates evolutionary importance

• The "UPF" (Uncharacterized Protein Family) designation indicates that this protein belongs to a family with unknown function

Research approaches to elucidate function might include:

• Knockout/knockdown studies to observe phenotypic effects

• Protein interaction studies using co-immunoprecipitation or proximity labeling

• Subcellular localization studies to determine membrane compartment specificity

• Comparative studies with the human ortholog C8orf40

How can researchers design experiments to investigate protein-protein interactions involving Mouse UPF0697 protein?

To investigate protein-protein interactions of Mouse UPF0697 protein:

• Co-immunoprecipitation (Co-IP): Use antibodies against UPF0697 protein or its tag to pull down interacting proteins from cell lysates, followed by mass spectrometry identification.

• Proximity-dependent biotin identification (BioID): Fuse UPF0697 protein with a biotin ligase that biotinylates nearby proteins, enabling streptavidin-based pulldown and identification.

• Yeast two-hybrid screening: Although challenging for membrane proteins, modified membrane yeast two-hybrid systems can be employed to detect interactions.

• Fluorescence resonance energy transfer (FRET): Tag UPF0697 protein and potential interacting partners with appropriate fluorophores to detect proximity-based energy transfer.

• Cross-linking mass spectrometry: Use chemical cross-linkers to stabilize transient interactions before analysis.

For membrane proteins like Smim19, maintaining the native membrane environment is crucial, so detergent selection or membrane-mimetic systems (nanodiscs, liposomes) should be carefully optimized .

What challenges are specific to studying small integral membrane proteins like Mouse UPF0697/Smim19?

Research on small integral membrane proteins like Mouse UPF0697/Smim19 presents several specific challenges:

• Protein extraction and solubilization: Maintaining native conformation while extracting from membranes requires careful detergent selection.

• Low expression levels: Natural expression is often low, necessitating overexpression systems that may impact localization or function.

• Difficult crystallization: Small membrane proteins are challenging to crystallize for structural studies.

• Limited immunogenicity: Generating specific antibodies can be difficult due to limited exposed epitopes and high conservation across species.

• Functional redundancy: Small membrane proteins often have redundant functions, making phenotype assessment in knockout studies challenging.

These challenges can be addressed by combining multiple complementary approaches, including advanced microscopy techniques, proximity labeling, and membrane mimetic systems for in vitro studies .

How can researchers distinguish between specific and non-specific effects in functional studies with recombinant Mouse UPF0697 protein?

To distinguish between specific and non-specific effects in functional studies:

• Use multiple protein preparations: Compare different batches and expression systems to rule out preparation-specific artifacts.

• Include appropriate controls: Use structurally similar but functionally distinct proteins (e.g., other small membrane proteins) as negative controls.

• Perform concentration-dependent studies: Specific effects typically show dose-dependency within physiological concentration ranges.

• Compare tagged vs. untagged proteins: Evaluate whether observed effects are consistent regardless of tag presence.

• Validate with genetic approaches: Complement protein addition studies with gene knockout/knockdown experiments.

• Competition assays: If a specific interaction is proposed, competition with increasing amounts of unlabeled protein should proportionally reduce the observed effect .

What imaging techniques are most appropriate for studying the subcellular localization of Mouse UPF0697 protein?

For studying the subcellular localization of Mouse UPF0697 protein C8orf40 homolog (Smim19):

• Confocal microscopy: Using fluorescently-tagged protein or immunofluorescence with specific antibodies provides high-resolution localization data.

• Super-resolution microscopy techniques:

  • Stimulated emission depletion (STED) microscopy

  • Photoactivated localization microscopy (PALM)

  • Stochastic optical reconstruction microscopy (STORM)
    These techniques overcome the diffraction limit to provide nanoscale resolution necessary for precise membrane localization.

• Correlative light and electron microscopy (CLEM): Combines fluorescence localization with ultrastructural context.

• Live-cell imaging: For dynamics of protein trafficking and localization changes in response to stimuli.

For optimal results, co-staining with established markers of cellular compartments (e.g., ER, Golgi, plasma membrane) is essential to definitively establish the localization of this membrane protein .

What are the considerations for developing antibodies against Mouse UPF0697 protein?

Developing effective antibodies against Mouse UPF0697 protein requires careful planning:

• Epitope selection: For membrane proteins like Smim19, target extracellular or cytoplasmic domains rather than transmembrane regions. Bioinformatic predictions can help identify exposed regions.

• Immunogen design options:

  • Synthetic peptides from hydrophilic regions

  • Recombinant protein fragments (avoiding transmembrane domains)

  • Full-length protein in detergent micelles or membrane mimetics

• Validation strategy:

  • Western blot of tissues known to express the protein

  • Immunostaining of cells with and without expression

  • Comparison with tagged protein expression patterns

  • Reduced or absent signal in knockout/knockdown samples

• Application-specific optimization:

  • For Western blots: Optimize membrane transfer conditions for hydrophobic proteins

  • For immunoprecipitation: Test multiple detergent conditions

  • For immunohistochemistry: Evaluate different fixation methods

Given the small size of the protein (107 amino acids), antibody development may be particularly challenging and may require extensive validation to ensure specificity .