Recombinant Mouse Uracil nucleotide/cysteinyl leukotriene receptor (Gpr17)

Shipped with Ice Packs
In Stock

Description

Introduction to GPR17

GPR17 (G protein-coupled receptor 17) is a class A orphan receptor with dual ligand specificity for uracil nucleotides (e.g., UDP-glucose, UDP-galactose) and cysteinyl leukotrienes (CysLTs; e.g., LTC₄, LTD₄). Initially identified as an orphan receptor, its deorphanization revealed its role in inflammatory responses and oligodendrocyte development . The recombinant mouse GPR17 protein is a lab-engineered version used to study receptor structure, signaling, and therapeutic potential.

Functional Signaling Pathways

GPR17 couples to Gi proteins, triggering downstream effects:

  • Inhibition of adenylyl cyclase: Reduces cAMP levels .

  • Calcium mobilization: Releases intracellular Ca²⁺ via Gαi-mediated pathways .

  • Oligodendrocyte regulation: Suppresses differentiation by upregulating ID2/ID4 proteins .

Recombinant Mouse GPR17: Production and Applications

The recombinant mouse GPR17 protein is typically expressed in E. coli with a His-tag for purification:

ParameterDetails
Expression SystemE. coli (commonly used for structural studies) .
TagN-terminal His-tag for affinity chromatography .
Applications- Structural studies (e.g., cryo-EM) .
- Ligand-binding assays .
- Signaling pathway analysis .

Research Findings and Biological Roles

GPR17’s recombinant form has elucidated its roles in:

Ischemic Injury and Neuroinflammation

  • Dual ligand responsiveness: Activated by CysLTs (EC₅₀: ~nM) and uracil nucleotides (EC₅₀: ~μM) .

  • Therapeutic target: Inhibition reduces brain damage in rodent ischemia models .

Oligodendrocyte Development

  • Maturation inhibitor: Overexpression delays myelination; knockout accelerates it .

  • Mechanism: Upregulates ID2/ID4 to block differentiation .

Glioma and Cancer

  • Tumor suppression: Overexpression induces apoptosis via ROS and inhibits PRC1-mediated RNF2 transcription .

Pharmacological Interactions

GPR17 interacts with ligands and modulators:

Ligand/AntagonistEffectSource
HAMI3379Inverse agonist; blocks Gi signaling and promotes oligodendrocyte maturation .
MontelukastPartial antagonist; inhibits CysLT binding .
CysLT1R AntagonistsMK-571; blocks CysLT1R-mediated responses in GPR17-deficient mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gpr17; Uracil nucleotide/cysteinyl leukotriene receptor; UDP/CysLT receptor; G-protein coupled receptor 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNGLEAALPSLTDNSSLAYSEQCGQETPLENMLFACFYLLDFILAFVGNALALWLFIWDH KSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFLFYLNMYASIY FLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWIVVAVAMAPLLVSPQTVQTNHTVV CLQLYREKASHHALASLAVAFTFPFITTVTCYLLIIRSLRQGPRIEKHLKNKAVRMIAMV LAIFLICFVPYHIHRSVYVLHYRGGGTSCAAQRALALGNRITSCLTSLNGALDPVMYFFV AEKFRHALCNLLCSKRLTGPPPSFEGKTNESSLSARSEL
Uniprot No.

Target Background

Function
GPR17 is a dual-specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). It signals through G(i) proteins, inhibiting adenylyl cyclase. It may mediate brain damage resulting from nucleotide and CysLT exposure following ischemic events.
Gene References Into Functions

References:

  1. Study on GPR17+ cell differentiation capabilities in rodent models of myelin disruption. PMID: 29424466
  2. Transcription factor FoxO1's regulation of glucose metabolism and feeding via GPR17 expression in hypothalamic AgRP neurons. PMID: 22682251
  3. Conditional knockout of hypothalamic AgRP neuron GPR17 improves glucose metabolism and energy homeostasis. PMID: 26180086
  4. Identification of GPR17 as a FoxO1 target mediating feeding regulation, suggesting its potential as a drug target for metabolic disorders. PMID: 22682251
  5. The role of GPR17-expressing oligodendrocyte precursor cells in post-stroke brain remodeling. PMID: 28594400
  6. GPR17 knockout in mice leads to precocious myelination and accelerated remyelination after demyelination. PMID: 27733608
  7. Lack of activation of human, mouse, or rat GPR17 by uracil nucleotides and cysteinyl leukotrienes. PMID: 28254957
  8. Differentiation of GPR17(+) cells after cerebral damage. PMID: 26464068
  9. MDL29,951's effect on myelin basic protein expression via GPR17 and Galphai/o signaling. PMID: 26620557
  10. Agrp-Gpr17(-/-) mice exhibit reduced food intake, increased energy expenditure, and improved metabolic parameters. PMID: 26180086
  11. The role of the mouse GPR17 receptor in cardiac stromal cell response to ischemia. PMID: 24909956
  12. MDL29,951 activation of human, mouse, and rat GPR17. PMID: 24150254
  13. GPR17 as a marker for oligodendroglial progenitor progression and post-injury reactivity. PMID: 21956849
  14. Analysis of agonist-induced trafficking of native GPR17 in oligodendroglial cells. PMID: 23288840
  15. FoxO1's integrative control of leptin, insulin, and amino acid signaling in AgRP neurons, and its regulation of food intake via GPR17. PMID: 22682251
  16. GPR17 expression in oligodendrocyte precursor cells and its influence by culture conditions. PMID: 21264945
  17. GPR17's negative regulation of CysLT1R-mediated inflammation in allergic pulmonary inflammation. PMID: 20574000
  18. GPR17's role in the transition between immature and myelinating oligodendrocytes and its potential as a therapeutic target. PMID: 19838178
  19. GPR17's role in brain injury response and its potential role in neuronal death and remodeling. PMID: 18974869
  20. GPR17 as a negative regulator of the cysteinyl leukotriene 1 receptor response. PMID: 19561298
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR17 and how was it initially identified?

GPR17 is a G protein-coupled receptor originally cloned by homologous screening in human genomic DNA with the chemokine IL-8 receptor. It was later identified from human hippocampus cDNA library using nucleotide chicken P2Y1 and murine P2Y2 receptors as probes. Phylogenetic analysis revealed that human GPR17 shares significant homology with cysteinyl leukotriene receptors (CysLTRs), with amino acid sequence identity of 31% to human CysLT1R and 36% to CysLT2R. Human GPR17 shares approximately 90.3% amino acid sequence identity with its mouse and rat orthologs .

Where is GPR17 primarily expressed in mice?

GPR17 shows abundant expression in the mouse brain, as confirmed by Northern blot analysis. This expression pattern was further validated using β-galactosidase (lacZ) staining in GPR17-deficient mice, which revealed widespread expression throughout the brain. Beyond the central nervous system, GPR17 is notably expressed in oligodendrocyte precursors, suggesting its involvement in myelination processes. The receptor appears to play a more general function rather than having a specific role limited to AGRP neurons in the hypothalamus .

How can researchers generate and validate GPR17-deficient mouse models?

GPR17-deficient mouse strains can be generated using targeted gene disruption. In previously described models, the targeting vector was designed with a lacZ-neo gene cassette that interrupts 76 bp of the coding region on exon 2 of mouse GPR17. Genotyping can be performed using PCR with genomic tail DNA, utilizing GPR17 gene-specific primers and a neo gene primer. Wild-type alleles produce a 299-bp band, while mutant alleles yield a 440-bp band.

To validate successful knockout, Northern blot analysis of total RNA from brain tissue should be performed. In wild-type mice, a 6-kb band corresponding to GPR17 mRNA is typically detected, whereas this band should be absent in GPR17-deficient mice . Additional validation through functional assays examining downstream signaling pathways can further confirm the knockout phenotype.

What methods are recommended for studying GPR17 and chemokine receptor interactions?

Several complementary approaches are recommended for investigating GPR17 interactions with chemokine receptors such as CXCR2 and CXCR4:

  • Co-immunoprecipitation: Cell lysates from cells co-expressing GPR17 and the chemokine receptor of interest can be immunoprecipitated with anti-GPR17 antibodies, followed by Western blot analysis using antibodies against the chemokine receptor.

  • Immunoenzymatic assays: These provide quantitative measurements of receptor interactions. Plates can be coated with anti-GPR17 antibodies, incubated with cell lysates, and then probed with antibodies against chemokine receptors.

  • Molecular modeling: Homology modeling and molecular dynamics simulations can provide insights into the structural basis of receptor interactions.

  • Functional assays: Measure receptor-mediated modulation of intracellular signaling pathways, such as cyclic adenosine monophosphate (cAMP) levels, to assess functional consequences of receptor interactions .

These methods should be used in combination to provide comprehensive evidence of receptor interactions and their functional significance.

How does GPR17 modulate CysLT1R signaling?

GPR17 functions as a negative regulator of CysLT1R signaling through a mechanism involving receptor association rather than direct ligand competition. When GPR17 is co-expressed with CysLT1R, it eliminates CysLT1R binding and calcium signaling in response to LTD4 without preventing CysLT1R expression at the cell membrane. This negative regulation appears to involve:

  • Heterodimer formation: GPR17 likely forms heterodimers with CysLT1R, altering its signaling capabilities.

  • Membrane expression regulation: Knockdown of GPR17 in mouse bone marrow-derived macrophages (BMMΦs) increases membrane expression of CysLT1R.

  • Signaling sensitivity modulation: GPR17 knockdown increases both the magnitude and sensitivity of LTD4-induced calcium flux.

This regulatory role has been physiologically validated in vivo, where GPR17-deficient mice showed enhanced vascular permeability in IgE-dependent passive cutaneous anaphylaxis (PCA) compared to wild-type littermates, with this enhanced response being sensitive to the CysLT1R antagonist MK-571 .

What is known about the heterodimeric interactions between GPR17 and chemokine receptors?

GPR17 can form functional heterodimers with chemokine receptors CXCR2 and CXCR4. These interactions exhibit the following characteristics:

These findings suggest intricate cross-talk mechanisms between GPR17 and chemokine receptors that may play important roles in neuroinflammatory processes associated with demyelination.

What is the role of GPR17 in metabolic regulation and glucose homeostasis?

Despite initial hypotheses suggesting GPR17 involvement in metabolic regulation, comprehensive studies with GPR17-deficient mice revealed:

  • Normal food intake and body weight: GPR17-deficient mice showed similar food intake and body weight compared to wild-type littermates, both on standard chow diet and after high-fat feeding.

  • Normal hypothalamic AGRP expression: No differences were observed in hypothalamic Agrp mRNA expression or circulating AGRP levels between GPR17-deficient and wild-type mice.

  • Unaltered glucose homeostasis: Oral glucose tolerance tests and insulin tolerance tests demonstrated normal glycemic control in GPR17-deficient mice compared to wild-type mice.

  • No protection against diet-induced insulin resistance: GPR17-deficient mice were not protected from high-fat diet-induced glucose intolerance or insulin resistance.

These findings contradict earlier suggestions that GPR17 might be a therapeutic target for obesity or type 2 diabetes, indicating that GPR17 does not play a significant role in controlling food intake, body weight, or glycemic control .

What is the proposed role of GPR17 in central nervous system myelination?

GPR17 is expressed in oligodendrocyte precursors and appears to play a regulatory role in CNS myelination:

  • Negative regulation by Olig1: GPR17 is negatively regulated by the oligodendrocyte maturation transcription factor Olig1.

  • Impact on myelination timing: While GPR17 ablation in mice caused only a slight advance in CNS myelination, overexpression of GPR17 significantly inhibited myelinogenesis within the CNS.

  • Relevance to CNS injury: Knockdown of GPR17 mRNA levels in a focal ischemia rat model attenuated short-term neuron loss, brain atrophy, and microglial activation after reperfusion.

These findings suggest that GPR17 may control oligodendrocyte function and maturation rather than directly affecting AGRP neuronal activity. The receptor appears to have potential relevance in both developmental myelination processes and pathological conditions involving demyelination or CNS injury .

How should researchers address contradictory findings regarding GPR17 ligand specificity?

The contradictory findings regarding GPR17 ligand specificity require careful methodological considerations:

ApproachDescriptionConsiderations
Cell type selectionUse multiple cell lines (1321N1, CHO, HEK-293T)Different cell backgrounds may express varying levels of signaling components
Receptor expression verificationConfirm receptor expression by multiple methods (Western blot, FACS, immunocytochemistry)Ensure consistent expression across experimental conditions
Multiple signaling readoutsAssess different downstream pathways (calcium flux, [35S]GTPγS binding, cAMP)Some ligands may preferentially activate specific pathways
Positive controlsInclude known GPCR-ligand pairs as controlsEnsures assay functionality
Concentration rangesTest wide concentration ranges of potential ligandsAccount for potential low-affinity interactions
Cross-validationVerify findings using both recombinant systems and endogenous expression contextsConfirm physiological relevance

When conducting ligand binding studies, researchers should be aware that GPR17 might function more as a modulator of other receptors rather than as a direct ligand-binding receptor. The potential for heterodimer formation with other receptors should be considered when interpreting ligand binding and signaling data .

What considerations are important when designing experiments to study GPR17 heterodimer formation?

When investigating GPR17 heterodimeric interactions, researchers should consider:

  • Expression level control: Ensure consistent expression levels of both receptors, as overexpression might lead to artificial interactions. Use inducible expression systems or carefully titrated transfection protocols.

  • Specificity controls: Include negative controls with unrelated GPCRs to confirm the specificity of observed interactions.

  • Multiple detection methods: Employ complementary approaches (co-immunoprecipitation, proximity ligation assays, FRET/BRET, etc.) to strengthen evidence for receptor interactions.

  • Functional relevance: Investigate the functional consequences of heterodimer formation on signaling pathways, ligand binding, receptor trafficking, and physiological responses.

  • Pharmacological modulation: Examine how ligands of either receptor affect heterodimer formation and function. Test both agonists and antagonists, individually and in combination.

  • Physiological context: Validate findings in systems with endogenous receptor expression to confirm physiological relevance .

How can researchers investigate the physiological significance of GPR17's negative regulation of CysLT1R?

To investigate the physiological significance of GPR17's negative regulation of CysLT1R, researchers should consider:

  • Tissue-specific knockout models: Generate conditional knockout models to delete GPR17 in specific cell types or tissues relevant to CysLT1R function.

  • Inflammatory challenge models: Examine responses to inflammatory challenges in GPR17-deficient vs. wild-type mice, with particular attention to CysLT1R-mediated processes such as:

    • Vascular permeability (passive cutaneous anaphylaxis models)

    • Bronchial hyperresponsiveness (asthma models)

    • Inflammatory cell recruitment

  • Rescue experiments: Attempt to rescue phenotypes in GPR17-deficient mice by administering CysLT1R antagonists like MK-571.

  • Temporal regulation: Investigate whether the regulatory relationship between GPR17 and CysLT1R changes during development or under pathological conditions.

  • Human relevance: Explore whether polymorphisms in GPR17 correlate with altered inflammatory responses or susceptibility to conditions involving CysLT1R signaling .

What are promising research avenues for GPR17 in neuroinflammation and demyelinating disorders?

Given GPR17's expression in oligodendrocyte precursors and its interactions with chemokine receptors, several promising research directions include:

  • Multiple sclerosis models: Investigate GPR17 expression and function in experimental autoimmune encephalomyelitis and other MS models, focusing on:

    • Impact on demyelination/remyelination processes

    • Modulation of neuroinflammatory responses

    • Potential as a therapeutic target for promoting remyelination

  • Receptor cross-talk in neuroinflammation: Further characterize the functional consequences of GPR17 heterodimeric interactions with CXCR2 and CXCR4 in:

    • Oligodendrocyte precursor cell migration and differentiation

    • Microglia and astrocyte activation

    • Blood-brain barrier integrity

  • Development of selective modulators: Design and test compounds that selectively target GPR17 or GPR17 heterodimers to:

    • Promote oligodendrocyte maturation

    • Enhance remyelination efficiency

    • Attenuate inflammatory responses

What technological advances might enhance our understanding of GPR17 biology?

Emerging technologies that could advance GPR17 research include:

  • Single-cell analysis: Apply single-cell RNA sequencing and proteomics to better understand GPR17 expression patterns across cell types and states, particularly in heterogeneous systems like the CNS.

  • Advanced imaging techniques: Utilize super-resolution microscopy and live-cell imaging to visualize GPR17 localization, trafficking, and interactions with other receptors in real-time.

  • CRISPR-based approaches: Employ CRISPR-Cas9 technology for:

    • Precise genome editing to study GPR17 regulatory elements

    • Creation of reporter lines for monitoring GPR17 expression

    • High-throughput screening of factors influencing GPR17 expression and function

  • Computational modeling: Apply molecular dynamics simulations and AI-based predictions to:

    • Model receptor heterodimer interfaces

    • Predict potential ligands

    • Design targeted modulators of GPR17 function

These technological advances would provide deeper insights into the complex biology of GPR17 and potentially identify novel therapeutic opportunities for conditions involving myelination defects or neuroinflammation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.