Recombinant Mouse Uroplakin-1a (Upk1a)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Mouse Uroplakin-1a (Upk1a) is a transmembrane protein belonging to the tetraspanin family. It forms part of the asymmetric unit membrane (AUM) in terminally differentiated urothelial cells, contributing to bladder epithelial stability and membrane permeability regulation . Upk1a heterodimerizes with Upk2 to create hexameric rings that strengthen the apical membrane during bladder distension .

Diagnostic Marker in Urothelial Carcinomas

  • Upk1a immunostaining is positive in 42.6–98% of urothelial tumors, aiding differentiation from prostate cancers (typically negative) .

  • Reduced Upk1a correlates with advanced tumor stage (pT2–4 vs. pTa, p<0.0001) and high-grade pTa bladder cancers (p<0.02) .

Functional Studies in Knockout Models

  • Upk1a⁻/⁻ mice show:

    • 30% reduction in sperm count .

    • Impaired bacterial clearance against E. coli .

    • Altered testicular transcriptomes (1,128 genes absent; 2,330 genes uniquely expressed) .

Cell Conversion and Regenerative Medicine

  • Fibroblasts transduced with FOXA1, TP63, MYCL, and KLF4 differentiate into urothelial-like cells (dUCs) expressing Upk1a .

  • Transplanted dUCs integrate into damaged mouse bladders and express urothelial markers (UPK1b, CDH1) .

Antibody Validation

  • Used as a positive control in Western blot (WB) and immunohistochemistry (IHC) .

  • Validated in protocols requiring citrate buffer (pH 6.0) antigen retrieval and EnVision detection systems .

Validation and Specificity

MethodFindings
Orthogonal ValidationConcordance with RNA-seq (Human Protein Atlas) and GTEx data .
Antibody ComparisonSpecificity confirmed via independent antibodies (e.g., MSVA-735M) .
Negative ControlsNo staining in colon, spleen, or non-urothelial tissues .

Limitations and Future Directions

  • Clinical Gaps: The prognostic significance of Upk1a in non-urothelial cancers remains unclear .

  • Mechanistic Insights: Upk1a’s role in sperm count regulation and bacterial defense requires further exploration .

  • Therapeutic Potential: Engineered dUCs show promise for bladder regeneration but lack terminal differentiation markers (e.g., UPK3a) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Upk1a; Uroplakin-1a; UP1a; Uroplakin Ia; UPIa; UPKa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Upk1a
Target Protein Sequence
MASAATEGEKGSPVVVGLLVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVF AGAWIAIFCGFSFFVVASFGVGAALCRRRYMILTYLLLMLIVYIFECASCITSYTHRDYM VSNPSLITKQMLTYYSADTDQGQELTRLWDRIMIEQECCGTSGPMDWVNYTSAFRAATPE VVFPWPPLCCRRTGNFIPINEDGCRVGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAIL MWTLPVMLIAMYFYTTL
Uniprot No.

Target Background

Function
Uroplakin-1a (Upk1a) is a component of the asymmetric unit membrane (AUM), a specialized biomembrane found in terminally differentiated urothelial cells. It plays a crucial role in normal bladder epithelial physiology. Upk1a may regulate membrane permeability of superficial umbrella cells or contribute to the stabilization of the apical membrane through AUM/cytoskeletal interactions.
Gene References Into Functions
  1. Mouse urothelium responds to the adhesion of type 1-fimbriated UPEC by activating a dual ligand/receptor system. This involves an interaction between FimH adhesin and uroplakin Ia, and another between lipopolysaccharide and Tlr4. PMID: 26549759
  2. Research indicates that SNX31 mediates the endocytic degradation of uroplakins. PMID: 24914955
  3. Despite lower expression levels, UPIa maintains its plaque association in urothelial preneoplastic lesions. PMID: 21853341
  4. Cryo-electron crystallography has been used to determine the structure of the major membrane protein complex from urinary bladder epithelial cells. PMID: 11718558
  5. Uroplakin Ia, the urothelial receptor for bacterial adhesin FimH, has been localized on the six inner domains of the 16 nm urothelial plaque particle. PMID: 11955018
  6. Studies have analyzed the glycan structures of uroplakins Ia and Ib. PMID: 16567801

Show More

Hide All

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Uroplakin-1a and what cellular structures is it associated with?

Uroplakin-1a (Upk1a) is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. It is a cell-surface protein characterized by the presence of four hydrophobic domains and is primarily found in the asymmetrical unit membrane (AUM) where it forms complexes with other transmembrane 4 superfamily proteins. Upk1a is highly specialized in mammalian urothelial surface cells and plays crucial roles in normal bladder epithelial physiology .

The protein's structure enables it to regulate membrane permeability of superficial umbrella cells and stabilize the apical membrane through AUM/cytoskeletal interactions. Additionally, research suggests Upk1a may function as a tumor suppressor under normal physiological conditions, although its expression has been observed to be dysregulated in certain cancers .

How does Uroplakin-1a contribute to urothelial cell differentiation?

Uroplakin-1a is closely related to urothelial cell differentiation, serving as a marker for terminal differentiation of urothelial cells. During differentiation, Upk1a is incorporated into the asymmetric unit membrane (AUM), a specialized structure that forms the apical surface of umbrella cells in the urothelium. The expression of Upk1a increases as urothelial cells progress through differentiation stages, with highest expression in fully differentiated umbrella cells .

For experimental determination of differentiation status, researchers can quantify Upk1a expression using immunofluorescence analysis or immunohistochemistry. These methods typically involve fixation of cells with 4% paraformaldehyde, permeabilization with Triton X-100, blocking with bovine serum albumin, and incubation with anti-Upk1a primary antibodies . Changes in Upk1a expression patterns can provide valuable insights into differentiation processes and potential dysregulation in disease states.

What is the molecular weight and structural characteristics of mouse Uroplakin-1a?

Mouse Uroplakin-1a has a molecular weight of approximately 29 kDa, although this may vary slightly depending on post-translational modifications . As a member of the tetraspanin family, Upk1a contains four transmembrane domains with both N-terminal and C-terminal regions situated in the cytoplasm. The protein features two extracellular loops, with the larger second extracellular loop containing conserved cysteine residues that form disulfide bonds critical for proper protein folding and function .

For experimental work requiring precise characterization, Western blot analysis can confirm the molecular weight using commercially available antibodies such as UPK1A/2922 or UPK1A/2923. Recombinant mouse Upk1a preparations should demonstrate a single band at approximately 29 kDa on SDS-PAGE under reducing conditions, although variations may occur based on expression systems and purification methods .

What antibody options are available for detecting mouse Uroplakin-1a in research applications?

Several monoclonal antibodies are available for detecting mouse Uroplakin-1a in research applications. Notable examples include UPK1A/2922 and UPK1A/2923, which are mouse monoclonal antibodies specifically developed for Uroplakin-1a detection . These antibodies are available in various formats, including unconjugated forms and conjugated variants with fluorescent labels such as CF®405S, CF®488A, and CF®568, providing flexibility for different experimental designs .

When selecting an antibody, researchers should consider the specific application requirements. For instance, while UPK1A/2923 has been validated for ELISA applications, different antibody clones may show varying sensitivities and specificities across applications such as Western blotting, immunohistochemistry, and immunofluorescence . It's worth noting that antibody performance can be optimized through techniques such as horseradish peroxidase-polymer detection systems visualized with 3,3′-diaminobenzidine, similar to approaches used with other uroplakin antibodies .

How should Uroplakin-1a expression be quantified in tissue samples for comparative studies?

For accurate quantification of Uroplakin-1a expression in tissue samples, immunohistochemistry (IHC) with a standardized scoring system is recommended. After tissue processing and incubation with anti-Upk1a antibodies, expression can be quantified using a combined scoring system that evaluates both staining intensity and extent .

A validated methodology involves scoring staining intensity as follows: 0 (negative), 1 (weak), 2 (medium), 3 (strong). The extent of staining should be scored as: 0 (≤10%), 1 (11%-25%), 2 (26%-50%), 3 (51%-75%), and 4 (76%-100%). The total score is calculated by combining these values, resulting in a range from 0 to 7. For analytical purposes, a total score ≥4 can be defined as high expression, while <4 represents low expression .

For comparative studies, it is essential to include appropriate controls and analyze paired samples when possible. Statistical analysis should employ appropriate tests such as paired t-tests for comparing expression between tumor and adjacent normal tissues, or survival analysis methods like Kaplan-Meier with log-rank tests when correlating expression with clinical outcomes .

What are the optimal conditions for immunofluorescence detection of Uroplakin-1a in cultured cells?

For optimal immunofluorescence detection of Uroplakin-1a in cultured cells, the following protocol is recommended based on established research methodologies:

  • Culture cells on coverslips until they reach appropriate confluence (typically 60-80%)

  • Wash cells twice with phosphate-buffered saline (PBS) to remove media components

  • Fix cells with 4% paraformaldehyde at room temperature for 15 minutes

  • Permeabilize with 0.25% Triton X-100 for 10 minutes at room temperature

  • Block with 5% bovine serum albumin for 1 hour at room temperature

  • Incubate overnight at 4°C with primary anti-Upk1a antibody (recommended dilution 1:100)

  • Wash three times with PBS (5 minutes each)

  • Incubate with appropriate secondary antibody (e.g., rhodamine-conjugated anti-mouse IgG) for 1 hour at room temperature

  • Wash three times with PBS

  • Mount coverslips onto slides with mounting medium containing DAPI (0.2 μg/ml)

This protocol provides clear subcellular localization of Upk1a, typically showing membrane localization with potential cytoplasmic signal depending on the cell type and differentiation state. For consistent results, it's important to optimize antibody concentrations, incubation times, and washing steps for specific experimental conditions and cell types.

How does Uroplakin-1a expression change in the context of urothelial carcinoma, and what methods best detect these alterations?

Recent studies have revealed significant alterations in Uroplakin-1a expression in urothelial carcinoma compared to normal urothelium. While Upk1a has been suggested to have tumor suppressor functions in normal tissue, its expression patterns in urothelial carcinoma can be complex and stage-dependent. For optimal detection of these alterations, a multi-modal approach is recommended .

Immunohistochemistry using monoclonal antibodies such as UPK1A/2922 provides the most reliable detection of Upk1a in tissue specimens. When analyzing urothelial carcinoma samples, it's important to compare the sensitivity of different uroplakin antibodies. Research on related uroplakin family members has shown that newer antibodies like the Uroplakin II antibody (BC21) demonstrate superior sensitivity (79%) compared to older options like Uroplakin III antibodies BC17 (55%) and AU1 (34%) . A similar approach can be applied to Upk1a detection, with careful optimization of staining protocols.

For quantitative assessment of expression changes, combining immunohistochemistry with molecular techniques like RT-qPCR provides complementary data. Additionally, western blotting with carefully selected antibodies allows for protein-level quantification. When interpreting results, researchers should consider that heterogeneity within tumors may result in variable expression patterns, necessitating analysis of multiple regions within samples.

What role does Uroplakin-1a play in hepatocellular carcinoma progression, and how can this be experimentally validated?

To experimentally validate Upk1a's role in HCC progression, researchers can employ several approaches:

  • Expression analysis: Compare Upk1a expression in paired HCC tissues and adjacent non-tumor samples using immunohistochemistry and quantitative PCR. Multiple datasets including GSE22058, GSE36376, and ICGC-LIPI-JP have confirmed significant upregulation in HCC .

  • Gene silencing experiments: Implement siRNA or shRNA approaches to silence Upk1a expression in HCC cell lines. This approach has revealed that Upk1a silencing suppresses glycolysis and proliferation in HCC cells .

  • Survival analysis: Correlate Upk1a expression levels with patient survival data using Kaplan-Meier analysis and log-rank tests. Univariate and multivariate analyses can establish whether Upk1a serves as an independent prognostic factor .

  • Functional assays: Assess changes in cellular proliferation, migration, and metabolism following Upk1a modulation using techniques such as MTT/CCK-8 assays, wound healing assays, and glucose consumption/lactate production measurements .

These methodological approaches provide comprehensive insights into Upk1a's functional significance in HCC progression and potential as a therapeutic target.

What are the current hypotheses regarding the mechanistic relationship between Uroplakin-1a and HIF-1α in cancer progression?

Recent research has uncovered a reciprocal regulatory relationship between Uroplakin-1a and Hypoxia-Inducible Factor 1α (HIF-1α) in cancer progression, particularly in hepatocellular carcinoma (HCC). The current hypothesis suggests a positive feedback loop where these proteins mutually regulate each other's expression and stability, contributing to cancer cell adaptation to hypoxic environments and enhanced glycolytic metabolism .

The proposed mechanism involves:

  • Upk1a upregulation in hypoxic tumor microenvironments

  • Increased Upk1a expression stabilizing HIF-1α protein by preventing its degradation

  • Stabilized HIF-1α upregulating genes involved in glycolysis and cell proliferation

  • HIF-1α, in turn, potentially increasing Upk1a expression, completing the feedback loop

This relationship has significant implications for understanding cancer metabolism and identifying potential therapeutic targets. To experimentally validate this hypothesis, researchers have employed gene silencing approaches combined with hypoxia-mimicking conditions. Assessing changes in protein expression, stability, and transcriptional activity provides insights into the functional relationship between these molecules .

Gene Set Enrichment Analysis (GSEA) has further supported these findings by identifying correlations between Upk1a expression and hypoxia-related gene signatures. Future research directions include investigating the specific molecular interactions and potential protein complexes involving Upk1a and HIF-1α, as well as exploring how this regulatory axis might be targeted therapeutically.

What expression systems are optimal for producing functional recombinant mouse Uroplakin-1a protein?

Producing functional recombinant mouse Uroplakin-1a protein presents unique challenges due to its multiple transmembrane domains and complex folding requirements. Based on current research practices with similar membrane proteins, the following expression systems can be considered, each with specific advantages:

  • Mammalian expression systems: HEK293 or CHO cells provide the most appropriate post-translational modifications and proper protein folding. These systems are preferred when structural integrity and functional activity are critical. Transient transfection using lipid-based reagents or stable cell line generation using lentiviral vectors both yield satisfactory results .

  • Baculovirus-insect cell systems: Sf9 or Hi5 insect cells offer a compromise between proper eukaryotic processing and higher yield compared to mammalian systems. This approach is particularly useful for structural studies requiring larger protein quantities.

  • E. coli-based systems: While challenging for full-length Upk1a due to transmembrane domains, bacterial expression may be suitable for producing soluble fragments (such as the large extracellular loop) for antibody production or interaction studies.

For optimal protein quality, inclusion of appropriate tags (such as His6 or FLAG) facilitates purification while minimizing interference with protein function. Purification strategies should employ gentle detergents (DDM, LMNG, or Brij-35) to maintain protein integrity during membrane extraction and chromatography steps.

What are the common challenges in immunohistochemical detection of Uroplakin-1a, and how can they be addressed?

Immunohistochemical detection of Uroplakin-1a presents several challenges that can affect sensitivity and specificity. Based on established protocols and research experience, these challenges and their solutions include:

  • Antibody specificity issues: Cross-reactivity with other uroplakin family members can occur. Solution: Perform validation using positive and negative control tissues, and compare results with multiple antibody clones. The UPK1A/2922 antibody demonstrates good specificity but should be validated in each experimental context .

  • Antigen retrieval optimization: Insufficient antigen retrieval can yield false-negative results. Solution: Optimize antigen retrieval conditions by testing different buffers (citrate pH 6.0 vs. EDTA pH 9.0) and heating methods (microwave, pressure cooker, or water bath).

  • Variable expression levels: Upk1a expression can vary significantly between samples and within different regions of the same sample. Solution: Analyze multiple fields per sample (minimum 5-10 fields) and implement standardized scoring systems that account for both staining intensity and percentage of positive cells .

  • Background staining: Non-specific binding can complicate interpretation. Solution: Extend blocking steps (30-60 minutes with 5% BSA or normal serum), optimize antibody dilutions, and include appropriate washing steps after primary and secondary antibody incubations.

  • Tissue fixation variables: Overfixation can mask epitopes. Solution: Standardize fixation protocols (recommended: 10% neutral buffered formalin for 24-48 hours) and perform comparative studies using the same fixation conditions.

By addressing these methodological considerations, researchers can achieve more consistent and reliable detection of Uroplakin-1a in tissue samples, enhancing data reproducibility and interpretation.

How can researchers effectively distinguish between endogenous and recombinant Uroplakin-1a in experimental systems?

Distinguishing between endogenous and recombinant Uroplakin-1a in experimental systems is crucial for accurate interpretation of functional studies. Several methodological approaches can be implemented to effectively differentiate between these forms:

  • Epitope tagging: Incorporate distinct tags (His, FLAG, HA, or V5) into recombinant Upk1a constructs. These tags allow selective detection using tag-specific antibodies in Western blot, immunoprecipitation, or immunofluorescence applications, while having minimal impact on protein function when positioned at the C-terminus .

  • Species-specific detection: When working in cross-species systems (e.g., human recombinant Upk1a in mouse cells), leverage species-specific antibodies that recognize unique epitopes in human versus mouse Upk1a. This approach is particularly valuable when tags might interfere with protein function.

  • Controlled expression systems: Utilize inducible expression systems (Tet-On/Off) to modulate recombinant Upk1a levels. By comparing induced versus non-induced conditions, researchers can attribute observed changes specifically to the recombinant protein.

  • Knockout/knockdown background: Generate cell lines with CRISPR/Cas9-mediated knockout or shRNA-mediated knockdown of endogenous Upk1a, then introduce the recombinant protein. This creates a "clean" background where all detected Upk1a is of recombinant origin.

  • Quantitative Western blotting: For systems where both forms are present, perform quantitative Western blotting with calibrated standards. Recombinant protein often shows higher expression levels and may exhibit slight molecular weight differences due to tags or expression system-specific post-translational modifications.

These strategies, used individually or in combination, provide researchers with robust methods to distinguish between endogenous and recombinant Upk1a in various experimental contexts, enabling more precise functional characterization and mechanistic studies.

How is Uroplakin-1a being investigated as a potential biomarker for cancer detection and prognosis?

Uroplakin-1a is emerging as a promising biomarker for cancer detection and prognosis, particularly in urothelial carcinoma and hepatocellular carcinoma. Current research indicates that Upk1a expression patterns may provide valuable diagnostic and prognostic information .

For biomarker implementation, standardized detection methods are essential. Immunohistochemistry using optimized protocols and validated antibodies such as UPK1A/2922 or UPK1A/2923 provides the most reliable tissue-based detection . The scoring system combining staining intensity (0-3) and extent of expression (0-4) yields a total score range of 0-7, with scores ≥4 typically classified as high expression .

Beyond tissue-based detection, research is exploring less invasive approaches such as detection of Upk1a mRNA in circulating tumor cells or cell-free RNA in blood samples. These liquid biopsy approaches could potentially provide real-time monitoring capabilities without requiring repeated tissue sampling.

What are the latest findings regarding the role of Uroplakin-1a in regulating cellular metabolism in cancer cells?

Recent investigations have revealed an unexpected role for Uroplakin-1a in regulating cancer cell metabolism, particularly glycolysis. In hepatocellular carcinoma, Upk1a has been shown to influence metabolic reprogramming through interactions with key regulatory pathways .

Experimental evidence indicates that silencing Upk1a suppresses glycolysis in HCC cells, suggesting a pro-glycolytic function. This metabolic regulation appears to be mediated through a reciprocal relationship with Hypoxia-Inducible Factor 1α (HIF-1α), a master regulator of cellular adaptation to hypoxia. The proposed mechanism involves Upk1a stabilization of HIF-1α protein, leading to enhanced expression of glycolytic enzymes and glucose transporters .

Metabolic assays measuring glucose consumption, lactate production, and extracellular acidification rates (ECAR) have demonstrated significant reductions in glycolytic capacity following Upk1a knockdown. Additionally, expression analyses have shown correlations between Upk1a levels and glycolytic enzyme expression in patient samples .

This emerging understanding of Upk1a's metabolic functions represents a paradigm shift, as uroplakins were traditionally considered primarily structural proteins. These findings suggest potential therapeutic strategies targeting Upk1a-mediated metabolic adaptations in cancer. Future research should explore the specific molecular interactions between Upk1a and metabolic regulators, as well as potential synergies between metabolic inhibitors and Upk1a-targeting approaches.

How do post-translational modifications affect Uroplakin-1a function, and what techniques are optimal for their characterization?

Post-translational modifications (PTMs) of Uroplakin-1a play crucial roles in regulating its localization, interactions, and function, though this area remains relatively unexplored compared to other aspects of Upk1a biology. Current research suggests several key modifications may influence Upk1a activity in both normal and pathological contexts .

Potential PTMs affecting Uroplakin-1a include:

  • Glycosylation: N-linked glycosylation likely occurs in the extracellular domains, potentially affecting protein folding, stability, and interaction with other AUM components. Site-directed mutagenesis of predicted glycosylation sites can help determine their functional significance.

  • Phosphorylation: Cytoplasmic domains may contain phosphorylation sites that regulate signaling capabilities. Phosphorylation status may change during urothelial differentiation or in response to cellular stress.

  • Ubiquitination: This modification could regulate Upk1a turnover and degradation, potentially playing a role in cancer contexts where protein levels are altered.

For comprehensive characterization of these modifications, a multi-technique approach is recommended:

  • Mass spectrometry: LC-MS/MS analysis of purified Upk1a can identify modification sites and quantify modification stoichiometry. Techniques like Electron Transfer Dissociation (ETD) preserve labile modifications during analysis.

  • Site-directed mutagenesis: Mutating specific residues predicted to undergo modification, followed by functional assays, establishes the biological significance of individual PTMs.

  • Phospho-specific or glyco-specific antibodies: When available, these allow tracking of specific modified forms in different cellular contexts.

  • 2D gel electrophoresis: This approach can separate different Upk1a proteoforms based on charge and mass differences resulting from PTMs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.