Recombinant Mouse Urotensin-2 receptor (Uts2r)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology and Pathology

Uts2r mediates diverse biological processes, including:

Cardiovascular Regulation

  • Vasoconstriction: Uts2r activation by urotensin II induces potent vasoconstriction, exceeding effects of endothelin-1 .

  • Stress Response: Modulates adrenocorticotropic hormone release via hypothalamic PVN activation .

Metabolic Disorders

  • Insulin Resistance: Polymorphisms in Uts2r correlate with elevated plasma glucose and insulin resistance in humans .

  • Fat Metabolism: Regulates skeletal muscle fat accumulation and Δ9 desaturase activity for fatty acid synthesis .

Cancer Progression

In glioblastoma (GBM), Uts2r overexpression is linked to:

MechanismObservation
AngiogenesisUII stimulates endothelial cell tubulogenesis and macrophage invasion .
Tumor AggressivenessHigh Uts2r expression correlates with hypoxia, necrosis, and MMP-2/9 upregulation .
PrognosisPatients with elevated Uts2r mRNA show shorter survival (Kaplan-Meier analysis) .

Research Applications

Recombinant Uts2r is used to study:

Disease Mechanisms

  • Diabetes: Investigating Uts2r polymorphisms linked to type 2 diabetes mellitus (T2DM) .

  • Cancer: Testing inhibitors (e.g., urantide, palosuran) to block UII-induced angiogenesis in GBM models .

Drug Development

  • Antagonists: Non-peptide inhibitors like palosuran disrupt Uts2r signaling in in vitro tubulogenesis assays .

  • Therapeutic Targets: Uts2r’s role in metabolic syndrome and schizophrenia is under exploration .

  • His-Tag: Facilitates purification via affinity chromatography .

  • Species Cross-Reactivity: Used in studies comparing human and rodent Uts2r signaling .

Key Studies

  1. Fatty Acid Metabolism: Uts2r mutations alter Δ9 desaturase activity, impacting monounsaturated fatty acid levels in Wagyu cattle .

  2. GBM Pathogenesis: Uts2r expression in mesenchymal GBM subgroups correlates with poor prognosis .

  3. Anticancer Therapies: URP (Uts2d-encoded peptide) inhibits angiogenesis in vitro but shows limited in vivo efficacy .

Limitations

  • Species-Specific Effects: Mouse Uts2r may not fully replicate human receptor behavior in disease models.

  • Cellular Heterogeneity: Variable Uts2r expression across glioma cell lines complicates therapeutic target validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Uts2r; Gpr14; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; Urotensin II receptor; UR-II-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MALSLESTSFPMLAVSRSTASELPGGFNVSHNSSWTGPTDPSSLQDLVATGVIGAVLSTM GVVGVVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIVATYVTKDWHFGDV GCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLALGTWLLALLLT LPMMLAIRLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYIRLARAYWLS QQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHQAMPLTPETARIINYL TACLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCRGPGSAGSFLSSRVHLQQDSGR SLSSNSQQATETLVLSPVPPNGAFV
Uniprot No.

Target Background

Function
The Urotensin-2 receptor (Uts2r) is a high-affinity receptor for urotensin-2 and urotensin-2B. Its activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. The UII/UTR system plays a role in lipopolysaccharide (LPS)/D-galactosamine (GalN)-induced acute liver failure. PMID: 23755157
  2. Findings demonstrate a significant role for UII in the pathogenesis of metabolic syndrome and suggest that UT receptor antagonists could be a novel therapeutic approach for treating this syndrome. PMID: 24297699
  3. Besides its function at the neuromuscular junction, urotensin II may regulate motor function by modulating motoneuron activity within the spinal cord. PMID: 20620192
  4. Elevated expression of Uts2r in skeletal muscle of diabetic mice has been reported. PMID: 19323985
  5. Urotensin II receptor knockout mice on an ApoE knockout background fed a high-fat diet exhibit an enhanced hyperlipidemic and atherosclerotic phenotype. PMID: 19696412
  6. In the CNS, Utsr mRNAs are expressed in brainstem and spinal motoneurons, the medial vestibular nucleus, locus coeruleus, and the ventral medulla. Peripherally, mRNAs are expressed in skeletal muscle, testis, vagina, stomach, gall bladder, and prostate. PMID: 18710417
  7. The upregulation of vascular U-II receptor (UT), GPR14, might be involved in the pathogenesis of atherosclerosis. PMID: 16325305
  8. The role of urotensin-II and its receptors in sepsis-induced lung injury under diabetic conditions has been investigated. PMID: 29133126

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of mouse Uts2r and how does it compare to other species?

The mouse Urotensin-2 receptor (Uts2r) gene has a distinctive genomic organization characterized by a single exon structure, as revealed by genomic cloning studies. This is in contrast to the mouse preproU-II gene which has four exons. The mouse Uts2r encodes a protein of 386 amino acids, while the monkey ortholog consists of 389 amino acids . This genomic structure is conserved across species, suggesting evolutionary importance for this receptor's function. The genomic clones for mouse Uts2r were isolated from mouse RPCI-22 mouse BAC library using specific PCR primers, with the sequence determined through subcloning into pBluescript II .

How does the amino acid sequence and pharmacological profile of mouse Uts2r compare to primates?

Mouse Uts2r shows notable species-specific differences compared to primate orthologs. The mouse receptor protein is 386 amino acids in length, while the monkey receptor is 389 amino acids . Despite these differences, ligand binding studies demonstrate that both receptors bind to human U-II with high affinity, although with different binding parameters:

ParameterMouse Uts2rMonkey UT
Kd654±154 pM214±65 pM
Bmax1011±125 fmol mg⁻¹497±68 fmol mg⁻¹

Competition binding analysis shows that various U-II isopeptides (mammalian, amphibian, and piscine) bind with similar high affinity (Ki=0.8-3 nM) to both receptors . Functionally, exposure to human U-II results in intracellular Ca²⁺ mobilization with EC₅₀ values of 3.2±0.8 nM and 1.1±0.3 nM for mouse and monkey UT receptors, respectively .

What expression systems are most effective for producing functional recombinant mouse Uts2r?

For production of functional recombinant mouse Urotensin-2 receptor (Uts2r), several expression systems have proven effective, each with specific advantages depending on the research application:

  • Prokaryotic Systems: E. coli-based expression systems are commonly used for structural and binding studies, as indicated by commercial recombinant Uts2r proteins . These systems typically incorporate N-terminal His tags for purification purposes.

  • Mammalian Expression Systems: For functional studies requiring proper post-translational modifications and membrane insertion, mammalian expression systems such as HEK-293 or CHO-K1 cells are preferred . CHO-K1 cells in particular have been successfully employed to express mouse Uts2r for membrane preparation used in binding assays.

For quality control, each batch should undergo stringent testing including saturation radioligand binding assays to determine receptor concentration (Bmax) and affinity (Kd), as well as competition binding assays to verify affinity against known reference agonists and antagonists .

What are the optimal storage conditions for maintaining the stability of recombinant Uts2r preparations?

Optimal storage conditions for recombinant Urotensin-2 receptor (Uts2r) preparations vary depending on the form of the preparation and intended use duration:

  • Short-term storage (up to one month): Store at 2-8°C for freeze-dried powder forms or reconstituted protein .

  • Long-term storage (up to 12 months): Aliquot and store at -80°C to preserve functionality .

  • Buffer composition: For membrane preparations, storage in buffers containing cryoprotectants like sucrose (typically 10%) is beneficial. Standard buffer formulation for Uts2r membrane preparations is 50 mM Tris-HCL (pH 7.4), 0.5mM EDTA, 10mM MgCl₂, and 10% sucrose .

Thermal stability studies indicate that recombinant Uts2r has a loss rate of less than 5% within the expiration date under appropriate storage conditions, as determined by accelerated thermal degradation tests (37°C for 48h) showing no obvious degradation or precipitation . It's crucial to avoid repeated freeze/thaw cycles as these significantly reduce receptor stability and binding capacity.

What binding assays are most reliable for characterizing Uts2r-ligand interactions?

For characterizing Urotensin-2 receptor (Uts2r)-ligand interactions, several methodologies have proven reliable:

  • Radioligand Binding Assays: Using [¹²⁵I]human U-II as the labeled ligand has become the gold standard. These assays can be performed through either proximity methods (such as FlashPlate) or classical filtration methods . For mouse Uts2r, saturation binding assays have established parameters of Kd 654±154 pM and Bmax of 1011±125 fmol mg⁻¹ .

  • Competition Binding Assays: Essential for determining the affinity (Ki) of various ligands against the receptor. These have demonstrated that mammalian, amphibian, and piscine U-II isopeptides bind with similar high affinity (Ki=0.8-3 nM) to mouse Uts2r .

  • Fluorescence-Based Binding Assays: Using fluorescein isothiocyanate (FITC)-labeled U-II can confirm cell surface expression of recombinant Uts2r and provide visual confirmation of specific binding .

  • Functional Assays: Calcium mobilization assays using fluorescent calcium indicators (FLIPR technology) are effective for functional characterization, with EC₅₀ values for human U-II on mouse Uts2r established at 3.2±0.8 nM . Inositol phosphate (IP) formation assays can further confirm the Gq-coupled signaling pathway, with EC₅₀ values of 7.2±1.8 nM reported for mouse Uts2r .

How can one pharmacologically differentiate between agonist, antagonist, and partial agonist activity at Uts2r?

Differentiating between agonist, antagonist, and partial agonist activity at Urotensin-2 receptor (Uts2r) requires a combination of functional assays examining different signaling outcomes:

  • Full Agonists: Like Urotensin-II (U-II), produce maximal receptor activation in calcium mobilization assays (FLIPR) and inositol phosphate (IP) formation assays, with EC₅₀ values for mouse Uts2r at 3.2±0.8 nM and 7.2±1.8 nM respectively .

  • Partial Agonists: Such as [Orn⁸]U-II, exhibit submaximal efficacy in functional assays while still binding with high affinity in competition binding experiments .

  • Antagonists: Compounds like UFP-803 ([Pen⁵,DTrp⁷,Dab⁸]U-II(4–11)) can be identified by their ability to concentration-dependently shift the contractile response curve of U-II to the right without producing effects when administered alone, revealing a competitive type of antagonism with calculable pA₂ values (e.g., 7.46 for UFP-803) .

It's important to note that pharmacological profiles may vary between assay systems. For example, urantide ([Pen⁵,DTrp⁷,Orn⁸]U-II(4–11)) acts as a potent antagonist in rat aorta bioassays but shows residual agonist activity at human recombinant UT receptors in calcium mobilization assays , highlighting the importance of using multiple assay systems for comprehensive characterization.

What G proteins couple to mouse Uts2r and how does this affect downstream signaling pathways?

Mouse Urotensin-2 receptor (Uts2r) couples to multiple G protein subtypes, creating a complex signaling network:

  • Gαq/G11 Coupling: The primary coupling mechanism, activating phospholipase C leading to inositol phosphate formation and subsequent calcium mobilization from intracellular stores. This pathway has been well-characterized with EC₅₀ values of 7.2±1.8 nM for inositol phosphate formation and 3.2±0.8 nM for calcium mobilization in response to human U-II .

  • Gαi/o Coupling: Activates phosphatidylinositol-3 kinase (PI3K) pathways involved in lamellipodia formation and cellular polarity, particularly important for cell migration functions .

  • Gα13 Coupling: Activates Rho/ROCK kinases leading to actin stress fiber formation and actomyosin contraction, also critical for cell migration .

This dual coupling to both Gαi/o and Gα13 is proposed to be responsible for the chemokine-like properties of the urotensinergic system, with Gαi/o/PI3K signaling at the front of migrating cells and Rho/ROCK/MLCK at the rear, together enabling directional cell migration (Figure 1) . This mixed coupling pattern is similar to the CCL2/CCR2 chemokine system and explains how Uts2r activation can simultaneously regulate multiple aspects of cellular behavior.

How does Uts2r activation lead to EGFR transactivation and what are the implications for cell proliferation?

Urotensin-2 receptor (Uts2r) activation leads to epidermal growth factor receptor (EGFR) transactivation through several interconnected mechanisms with significant implications for cell proliferation:

  • ROS-Mediated Pathway: Production of reactive oxygen species (ROS) through NADPH oxidase activated by Uts2r. These ROS relieve the inhibition exerted by src homology 2-containing tyrosine phosphatase (SHP-2) on EGFR, thereby allowing the transduction of mitogenic signals .

  • ADAM-Mediated Pathway: Uts2r activation can trigger a disintegrin and metalloproteinase (ADAM), which cleaves the precursor of EGF, the heparin-binding EGF-like growth factor, releasing the active EGFR ligand .

  • ERK Activation: This EGFR transactivation subsequently activates the ERK signaling pathway, which is central to the promitogenic effects observed in various cell types expressing Uts2r .

The activation of ERK has been demonstrated in cell lines transfected with human UT cDNA as well as in native cells expressing the receptor, such as pig renal epithelial cells and rat smooth muscle cells . The promitogenic effects of the urotensinergic system have been observed in numerous cell types, providing a mechanism by which Uts2r can exert long-term effects on tissue remodeling rather than just acute physiological responses.

How does the Uts2r system contribute to cardiovascular function and disease?

The Urotensin-2 receptor (Uts2r) system plays complex roles in cardiovascular function and disease, with effects that extend beyond simple vascular tone regulation:

  • Vascular Remodeling: Rather than acute hemodynamic effects, the urotensinergic system appears more significant in long-term processes such as vascular remodeling. Studies in UII knockout mice showed no modification of vascular tone but exhibited reduced metabolic syndrome and atherosclerotic lesions compared to wild-type mice .

  • Signaling Pathways: The Uts2r system activates multiple signaling pathways relevant to cardiovascular pathophysiology, including ERK activation leading to cell proliferation and EGFR transactivation through ROS production or ADAM-mediated cleavage of EGF precursors .

  • Hypertrophy and Proliferation: These mechanisms can contribute to vascular smooth muscle hypertrophy and proliferation, common features in cardiovascular diseases such as hypertension and atherosclerosis .

  • Inflammatory Effects: The urotensinergic system can promote inflammation and cell migration, further contributing to pathological vascular remodeling .

These findings collectively suggest that U-II and Uts2r represent novel therapeutic targets for management of a variety of cardiovascular diseases, acting through mechanisms distinct from traditional cardiovascular drugs .

What evidence supports the role of Uts2r in cell migration and potential cancer development?

Substantial evidence supports the role of Urotensin-2 receptor (Uts2r) in cell migration and potential cancer development, positioning the urotensinergic system closer to chemokine functions than traditional cardiovascular mediators:

  • Migration Studies: Multiple independent studies have demonstrated that Urotensin-II (U-II) exerts stimulatory effects on cell migration across various cell types. The Rho/ROCK signaling pathway plays a major role in U-II-induced migration of rat fibroblasts, endothelial progenitor cells, and human monocytes .

  • Signaling Mechanisms: Recent work with glioma cell lines and recombinant HEK293 cells has revealed that Uts2r activation involves a signaling switch through Gα13/Rho/ROCK kinases and Gαi/o/PI3K pathways, which coordinate actin stress fibers, lamellipodia formation, and vinculin-stained focal adhesions to initiate directional migration and cell adhesion—sequential mechanisms in tumor invasion .

  • Autophagy Regulation: U-II-induced inhibition of autophagy has been identified as a key element in the migration of HEK293 cells expressing Uts2r or CXCR4, as well as U87 glioblastoma cells. This autophagy inhibition may locally protect proteins involved in actin remodeling and adhesion assembly at the leading edge of migrating cells .

  • Chemokine-Like Properties: The pro-migratory, pro-inflammatory, and invasiveness-promoting properties of the urotensinergic system bear striking similarities to established chemokine systems like CXCL12/CXCR4 or CCL2/CCR2, suggesting potential therapeutic applications in pathologies characterized by abnormal cellular migration .

  • Cancer Correlation: Urotensin-II R has been specifically correlated with human cortico-adrenal carcinoma proliferation , suggesting its potential involvement in cancer development beyond just migration.

How can Uts2r antagonists be appropriately evaluated for potential therapeutic applications?

Evaluating Urotensin-2 receptor (Uts2r) antagonists for potential therapeutic applications requires a comprehensive approach addressing several key considerations:

  • Species Differences: Due to species differences in receptor pharmacology, antagonists should be tested against both rodent and primate Uts2r orthologs to ensure translational relevance. This is particularly important since U-II acts as a systemic vasodilator in rats but elevates vascular resistance in primates, making rat models potentially misleading for cardiovascular applications .

  • Multiple Assay Systems: A combination of binding and functional assays should be employed, as compounds may show different profiles depending on the assay system. For example, urantide ([Pen⁵,DTrp⁷,Orn⁸]U-II(4–11)) acts as a potent antagonist in rat aorta bioassays but shows residual agonist activity in calcium mobilization assays with human recombinant receptors .

  • Long-Term Studies: Given the emerging evidence for Uts2r's role in cell migration and tissue remodeling, antagonist evaluation should extend beyond acute cardiovascular effects to include long-term studies examining inflammation, fibrosis, and cellular proliferation .

  • Tissue Distribution Considerations: Since the urotensinergic system is expressed in multiple tissues beyond the vasculature (including lung, pancreas, skeletal muscle, kidney, and liver), potential off-target effects should be thoroughly assessed .

  • Chemokine Function Evaluation: Based on the recent characterization of Uts2r as having chemokine-like functions, novel antagonists should be evaluated for their ability to block directional cell migration in models relevant to inflammation and cancer .

What are the most appropriate experimental models for studying Uts2r function in vivo?

Selecting appropriate experimental models for studying Urotensin-2 receptor (Uts2r) function in vivo requires careful consideration of species-specific differences and research objectives:

  • Cardiovascular Studies: Primate models may be more relevant than rodent models given that Urotensin-II (U-II) acts as a systemic vasodilator in rats but elevates vascular resistance in primates . This significant species difference makes the translation of findings from rat models to human applications potentially problematic for vascular tone studies.

  • Genetic Models: Uts2r knockout mice provide valuable insights into the receptor's physiological roles, particularly for studying metabolic syndrome and atherosclerosis, as U-II knockout mice show reduced pathology in these conditions compared to wild-type counterparts .

  • Cancer Models: For investigating the role of Uts2r in cell migration and cancer, xenograft models using cells with manipulated Uts2r expression levels can be employed, particularly given the correlation between Uts2r and cortico-adrenal carcinoma proliferation .

  • Migration Studies: When studying the chemokine-like functions of the urotensinergic system, in vivo migration assays such as air pouch models or Matrigel plug assays may be appropriate .

  • Tissue-Specific Models: Conditional knockout models would be particularly valuable for dissecting the role of Uts2r in specific organs, given its expression in multiple tissues including heart, pancreas, lung, skeletal muscle, kidney, and liver .

  • Pharmacological Validation: For pharmacological studies, it's essential to validate that any compounds used have appropriate affinity for the species-specific receptor variant being studied, as pharmacological parameters can vary significantly between species .

How can discrepancies between in vitro and in vivo results in Uts2r research be reconciled?

Discrepancies between in vitro and in vivo results in Urotensin-2 receptor (Uts2r) research can be reconciled by considering several factors that influence receptor function across different experimental contexts:

  • Species Differences: Urotensin-II (U-II) acts as a vasodilator in rats but increases vascular resistance in primates, making cross-species extrapolation problematic . This fundamental pharmacological difference must be accounted for when interpreting contradictory results.

  • Cellular Context: In recombinant systems where the receptor is overexpressed, signaling pathways may be amplified or altered compared to native tissues with physiological expression levels. The cellular environment dramatically affects Uts2r signaling .

  • Tissue-Specific Effects: The urotensinergic system demonstrates tissue-specific effects based on the local cellular environment, available signaling machinery, and presence of other regulatory systems. For example, a compound like urantide may act as an antagonist in rat aorta bioassays but show residual agonist activity in cell-based calcium mobilization assays .

  • Acute vs. Chronic Responses: Short-term in vitro assays may miss long-term effects on tissue remodeling that are evident in vivo. The urotensinergic system appears to be more involved in chronic tissue remodeling than acute physiological responses .

  • Dual Receptor Function: The emerging dual role of Uts2r as both a traditional GPCR and a chemokine-like receptor suggests different functional outcomes depending on experimental conditions that favor one role over the other .

To reconcile these discrepancies, researchers should employ multiple complementary models, spanning from molecular to cellular to physiological to whole-animal studies, while carefully controlling for species differences and experimental conditions.

What methodological approaches are most effective for investigating the proposed chemokine-like functions of the Uts2r system?

Investigating the proposed chemokine-like functions of the Urotensin-2 receptor (Uts2r) system requires specialized methodological approaches that effectively capture directional cell migration and associated molecular mechanisms:

  • Migration Assays:

    • Boyden chamber or transwell migration assays for quantitatively measuring chemotactic responses to Urotensin-II (U-II) gradients

    • Time-lapse microscopy to visualize real-time migration patterns, directionality, and morphological changes

  • Signaling Pathway Analysis:

    • Pharmacological inhibition with specific inhibitors of PI3K, Rho, and ROCK

    • Genetic manipulation through siRNA knockdown or CRISPR-Cas9 editing of pathway components

    • Visualization of pathway activation using fluorescent biosensors for active Rho or PIP3

  • Cytoskeletal Dynamics Assessment:

    • Immunofluorescence microscopy focusing on actin cytoskeleton reorganization

    • Analysis of lamellipodia formation and focal adhesion dynamics using vinculin staining

    • Live-cell imaging of cytoskeletal components in cells expressing fluorescently tagged proteins

  • Autophagy Monitoring:

    • LC3 puncta formation and p62 accumulation assessment to investigate the role of autophagy inhibition in Uts2r-mediated migration

  • In Vivo Validation:

    • Mouse models with fluorescently labeled cells expressing Uts2r to track migration in response to locally administered U-II

    • Tissue-specific conditional Uts2r knockout models to assess organ-specific functions

  • Comparative Studies:

    • Parallel experiments with established chemokine systems like CXCL12/CXCR4 or CCL2/CCR2 to identify shared mechanisms

    • Co-expression studies to determine potential receptor interactions or signaling crosstalk

These methodological approaches collectively provide a comprehensive framework for investigating the emerging role of the urotensinergic system as a chemokine-like signaling pathway involved in cell migration, tissue remodeling, and potentially cancer progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.