Recombinant Mouse V-type proton ATPase subunit S1 (Atp6ap1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Atp6ap1; Atp6ip1; Atp6s1; V-type proton ATPase subunit S1; V-ATPase subunit S1; Protein C7-1; V-ATPase Ac45 subunit; V-ATPase S1 accessory protein; Vacuolar proton pump subunit S1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-463
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
VATEQQVPLVLWSSDRNLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYT AALTAVRPSRVARDITMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAY KDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARY WFAMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHN FQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDH KGPTITLTQIV
Uniprot No.

Target Background

Function
Recombinant Mouse V-type proton ATPase subunit S1 (Atp6ap1) is an accessory subunit of the vacuolar (V)-ATPase proton pump, essential for acidifying secretory vesicle lumens. It directs V-ATPase to specific subcellular compartments, such as neuroendocrine secretory vesicles and osteoclast ruffled borders, regulating enzyme activity. It plays roles in membrane trafficking, Ca2+-dependent membrane fusion, and V-ATPase complex assembly. Under aerobic conditions, it participates in intracellular iron homeostasis by activating Fe2+ prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation.
Gene References Into Functions
  1. The mitochondrial H+-ATP synthase, by linking the Warburg effect to anabolic metabolism, facilitates de-differentiation during somatic cell reprogramming to induced pluripotent stem cells. PMID: 23287468
  2. Demonstrates the crucial role of Ac45 in osteoclast-mediated extracellular acidification and protease exocytosis, and its ability to guide lysosomal intracellular trafficking to the ruffled border. PMID: 22467241
  3. Suggests that, beyond its role in V-ATPase-mediated acidification, Ac45 plays diverse roles in osteoclast formation and function. PMID: 22087256
  4. Indicates that a3 V-ATPase promotes distant metastasis of B16-F10 cells by creating acidic environments through proton secretion. PMID: 21669964
  5. A dominant-negative point mutation (R740S) in the a3 subunit, impairing proton pumping and bone resorption, also uncouples proton pumping from ATP hydrolysis. PMID: 21305608
  6. Disruption of the vacuolar H+-ATPase a3-B2 subunit interaction inhibited osteoclast bone resorption. PMID: 20837476
  7. Targeted disruption of the Ac45 gene in embryonic stem cells affects blastocyst development, highlighting the V-ATPase's essential role in early embryonic development. PMID: 11989824
  8. In osteoclasts, activity-dependent accumulation of acids and Ca2+ in the closed extracellular compartment may serve as negative feedback for V-ATPase regulation. PMID: 16901940
  9. The cytoplasmic terminus of Ac45 contains elements crucial for its interaction with the V0 domain and efficient osteoclastic bone resorption. PMID: 18227071
  10. Suggests a role for furin in regulated secretion, particularly intragranular acidification, likely due to impaired Ac45 processing. PMID: 18713856
Database Links
Protein Families
Vacuolar ATPase subunit S1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane.
Tissue Specificity
Expressed in brain cortex (at protein level).

Q&A

What is the function of ATP6AP1 in normal cellular physiology?

ATP6AP1 serves as an accessory subunit of vacuolar-type H⁺-ATPase (V-ATPase), a multi-subunit enzyme complex responsible for acidification of intracellular compartments. Methodologically, researchers have established its role through knockout studies and protein interaction analyses. ATP6AP1 is essential for:

  • Proper assembly and stability of the V-ATPase complex

  • Regulation of V-ATPase activity through its interaction with the V₁ sector

  • Maintenance of lysosomal acidification

  • Facilitation of autophagosome-lysosome fusion by enhancing the interaction between Rab7 and the HOPS complex

These functions make ATP6AP1 critical for cellular processes requiring vesicular acidification, including endocytosis, protein degradation, and autophagy.

How can I verify the expression and localization of ATP6AP1 in mouse models?

To verify ATP6AP1 expression and localization, researchers can employ multiple complementary approaches:

  • Immunoblotting (Western blot): Use ATP6AP1-specific antibodies to detect protein expression levels in tissue homogenates. Include appropriate controls such as knockout tissues or cell lines.

  • Immunohistochemistry/Immunofluorescence: These techniques allow visualization of ATP6AP1 subcellular localization. ATP6AP1 typically colocalizes with lysosomal markers.

  • RT-qPCR: Quantify ATP6AP1 mRNA expression levels in different tissues or under various experimental conditions.

  • Live-cell imaging: For dynamic studies, fluorescent protein tagging (such as C-mNG fusion) can be used to monitor ATP6AP1 localization during cellular processes .

When designing these experiments, ensuring antibody specificity through appropriate controls is critical for accurate results.

What experimental models are suitable for studying ATP6AP1 function?

Several experimental models have proven effective for ATP6AP1 research:

  • Cell line models: Human and mouse cancer cell lines (especially colorectal and breast cancer lines) can be used for knockdown/knockout studies using siRNA, shRNA, or CRISPR-Cas9 .

  • Yeast models: Saccharomyces cerevisiae with its ATP6AP1 homolog (Oxr1p) provides a simplified system for studying V-ATPase assembly/disassembly mechanisms .

  • Mouse models: Tissue-specific conditional knockout mice can be generated to study the physiological roles of ATP6AP1 in specific organs while avoiding embryonic lethality.

  • Patient-derived xenografts: These models can be used to study ATP6AP1's role in cancer progression and drug resistance .

The choice of model should align with specific research questions, considering the conserved nature of ATP6AP1 function across species.

What is the molecular mechanism of ATP6AP1-mediated V-ATPase assembly and regulation?

ATP6AP1 regulates V-ATPase through multiple molecular mechanisms:

  • V-ATPase assembly: ATP6AP1 facilitates the association of V₁ (cytoplasmic) and V₀ (membrane) sectors. In yeast studies, the homolog Oxr1p has been shown to mediate reversible disassembly of V-ATPase in response to glucose starvation .

  • Conformational changes: ATP6AP1/Oxr1p binding induces conformational changes in peripheral stator stalks (particularly EG2) that affect V-ATPase activity .

  • Interaction with regulatory subunits: ATP6AP1 interacts with subunit C of V-ATPase with high affinity (Kd ~7 ± 1 nM, compared to ~67 ± 33 nM in the absence of subunit C) .

  • ATP-dependent regulation: ATP hydrolysis triggers the release of ATP6AP1 and subunit C from the V₁ subcomplex, allowing subunit H to adopt its autoinhibitory conformation .

These mechanisms involve complex protein-protein interactions that can be studied using techniques such as biolayer interferometry (BLI), co-immunoprecipitation, and structural biology approaches including cryo-electron microscopy.

How does ATP6AP1 contribute to autophagy regulation in cancer cells?

ATP6AP1 plays a dual role in autophagy regulation, particularly in cancer contexts:

  • Lysosomal acidification: ATP6AP1 enhances lysosomal acidification through proper V-ATPase assembly, which is critical for lysosomal enzyme activation and autophagy completion .

  • Autophagosome-lysosome fusion: ATP6AP1 facilitates this fusion by enhancing the interaction between Rab7 and the HOPS complex, independent of its role in V-ATPase regulation .

In breast cancer models, ATP6AP1 overexpression activates autophagy, which contributes to tamoxifen resistance. This suggests that combining autophagy inhibitors with tamoxifen might overcome resistance in tumors with high ATP6AP1 expression .

To study these mechanisms, researchers can:

  • Monitor autophagic flux using LC3-II/I ratio and p62 degradation

  • Assess lysosomal acidification with pH-sensitive dyes

  • Visualize autophagosome-lysosome fusion using fluorescent reporters

  • Perform proximity ligation assays to detect protein-protein interactions between Rab7 and HOPS components

What technical challenges exist in producing functional recombinant mouse ATP6AP1 for in vitro studies?

Producing functional recombinant ATP6AP1 involves several technical considerations:

  • Expression systems: Mammalian expression systems (HEK293, CHO) often yield properly folded protein but with lower yields. E. coli systems provide higher yields but may require refolding protocols.

  • Post-translational modifications: ATP6AP1 undergoes glycosylation, which affects protein folding and function. Insect cell systems (Sf9, Hi5) can provide appropriate eukaryotic modifications.

  • Purification challenges: Maintaining proper protein folding during purification requires optimized buffer conditions (pH, salt concentration, glycerol content).

  • Activity assessment: Functional assays should test both V-ATPase assembly promotion and autophagy regulation capabilities of the recombinant protein.

  • Storage conditions: The protein may require specific conditions to maintain stability and functionality during storage.

Researchers should validate recombinant protein functionality by testing its ability to bind V₁ subcomplexes in vitro using biochemical assays such as biolayer interferometry, which has been successfully employed with biotinylated Oxr1p (the yeast homolog) .

How can I investigate the prognostic value of ATP6AP1 in cancer research models?

To investigate ATP6AP1's prognostic value in cancer:

  • Expression analysis:

    • Analyze ATP6AP1 expression in tumor vs. normal tissues using immunohistochemistry, RT-qPCR, and western blotting

    • Compare expression with patient survival data using Kaplan-Meier plots

    • Construct ROC curves to evaluate ATP6AP1 as a diagnostic marker (AUC values in colorectal cancer: 0.855 for discovery set, 0.814 for validation set)

  • Functional validation:

    • Create stable ATP6AP1 overexpression and knockdown cell lines

    • Assess effects on proliferation, migration, invasion, and drug resistance

    • Perform xenograft studies to evaluate in vivo tumor growth and metastasis

  • Molecular mechanism studies:

    • Analyze correlation with immune cell infiltration (important in colorectal cancer)

    • Investigate associations with immune checkpoints and chemokines

    • Perform pathway enrichment analysis to identify associated biological processes

Table 1: Survival outcomes based on ATP6AP1 expression in rectal adenocarcinoma (READ) and colon adenocarcinoma (COAD)

How should I design ATP6AP1 knockout/knockdown experiments to study its function?

When designing ATP6AP1 knockout/knockdown experiments:

  • Choose appropriate systems:

    • Transient knockdown: siRNA for short-term studies (3-5 days)

    • Stable knockdown: shRNA or CRISPR-Cas9 for long-term studies

    • Inducible systems: Tet-on/off for temporal control of expression

    • Tissue-specific conditional knockout: For in vivo mouse studies to avoid embryonic lethality

  • Include essential controls:

    • Scrambled/non-targeting siRNA/shRNA

    • Empty vector controls

    • Rescue experiments by reintroducing wildtype ATP6AP1 to confirm phenotype specificity

    • Partial knockdowns to study dose-dependent effects

  • Validate knockdown efficiency:

    • mRNA levels (RT-qPCR)

    • Protein levels (Western blot)

    • Functional readouts (V-ATPase activity, lysosomal pH)

  • Investigate multiple phenotypic outcomes:

    • Cell proliferation and viability

    • Autophagy markers (LC3-II/I, p62)

    • Lysosomal function (acidity, enzyme activity)

    • Drug sensitivity (particularly in cancer models)

Importantly, complete ATP6AP1 knockout may be lethal or cause severe phenotypes that complicate interpretation. Consider using partial knockdowns or time-controlled systems to study the acute effects of ATP6AP1 depletion.

What are the key considerations for studying ATP6AP1 in cancer drug resistance mechanisms?

When investigating ATP6AP1's role in drug resistance, researchers should consider:

  • Model selection:

    • Use paired sensitive/resistant cell lines

    • Develop resistant lines through continuous drug exposure

    • Include patient-derived samples with known treatment responses

    • Consider 3D organoid models to better recapitulate tumor microenvironment

  • Mechanistic investigations:

    • Autophagy assessment: ATP6AP1 enhances tamoxifen resistance by activating autophagy in breast cancer

    • V-ATPase activity: Measure lysosomal acidification using pH-sensitive dyes

    • Signaling pathway analysis: Identify downstream effectors using phospho-proteomics

  • Combination approaches:

    • Test autophagy inhibitors (chloroquine, hydroxychloroquine) with chemotherapeutics

    • Evaluate V-ATPase inhibitors (bafilomycin A1, concanamycin A) in ATP6AP1-overexpressing tumors

    • Design targeted peptides to disrupt specific ATP6AP1 interactions

  • Clinical correlation:

    • Analyze patient samples before and after treatment to monitor ATP6AP1 expression changes

    • Correlate ATP6AP1 levels with treatment response and survival outcomes

The finding that ATP6AP1 promotes tamoxifen resistance in luminal breast cancer through autophagy activation provides a foundation for developing combination therapies targeting both estrogen receptor signaling and autophagy pathways .

How can I analyze the interaction network of ATP6AP1 in mouse models?

To comprehensively analyze ATP6AP1's interaction network:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • Yeast two-hybrid screening

    • Fluorescence resonance energy transfer (FRET) for direct interaction analysis

  • Functional interaction mapping:

    • CRISPR screens to identify synthetic lethal partners

    • Phospho-proteomics to identify signaling pathways affected by ATP6AP1

    • Transcriptomics to identify genes co-regulated with ATP6AP1

  • Data integration approaches:

    • Network analysis using tools like Cytoscape

    • Pathway enrichment analysis (GO, KEGG, Reactome)

    • Correlation analysis with biological processes (autophagy, lysosomal function)

  • Validation experiments:

    • Confirm key interactions using multiple methods

    • Perform domain mapping to identify specific interaction regions

    • Generate interaction-deficient mutants to test functional significance

In colorectal cancer studies, ATP6AP1 expression has been correlated with immune cell infiltration and cancer-associated fibroblasts in the tumor microenvironment, suggesting important interactions beyond the V-ATPase complex .

What approaches can be used to study the structural dynamics of ATP6AP1-V-ATPase interactions?

To study structural dynamics of ATP6AP1-V-ATPase interactions:

  • Structural biology approaches:

    • Cryo-electron microscopy to visualize ATP6AP1 in complex with V-ATPase components

    • X-ray crystallography for high-resolution structures of specific domains

    • NMR spectroscopy for studying dynamic interactions in solution

    • Molecular dynamics simulations to predict conformational changes

  • Biophysical interaction studies:

    • Biolayer interferometry (BLI) to measure binding kinetics (previously used to determine Kd values of ~67 ± 33 nM for V₁ΔH and ~7 ± 1 nM with subunit C)

    • Surface plasmon resonance (SPR) for real-time interaction analysis

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Analytical ultracentrifugation to study complex formation

  • Functional mutagenesis:

    • Site-directed mutagenesis of predicted interaction residues

    • Domain swapping experiments to identify functional regions

    • Generation of chimeric proteins to test domain-specific functions

Research with the yeast homolog Oxr1p revealed that it binds V₁ and affects the conformation of peripheral stator stalks, particularly EG2. This binding is mutually exclusive with the autoinhibitory binding of subunit H, explaining why Oxr1p does not bind autoinhibited V₁ .

How can I resolve contradictory data regarding ATP6AP1 expression across different cancer types?

When faced with contradictory data regarding ATP6AP1 expression:

  • Systematically evaluate data sources:

    • Consider sample sizes and statistical power of each study

    • Evaluate methodological differences (antibodies, RNA-seq platforms)

    • Assess patient cohort characteristics (demographics, treatment history)

    • Compare paired vs. unpaired tumor/normal comparisons

  • Perform meta-analysis:

    • Integrate data from multiple studies using proper statistical methods

    • Address batch effects using appropriate normalization techniques

    • Use random-effects models to account for between-study heterogeneity

  • Analyze context-specific factors:

    • Cancer subtypes may show different ATP6AP1 expression patterns

    • Consider tumor microenvironment and stromal content

    • Evaluate genetic background and mutation profiles

  • Conduct validation studies:

    • Use multiple detection methods (IHC, Western blot, qPCR)

    • Analyze larger, well-characterized cohorts

    • Include relevant clinical and pathological variables

Current data shows that ATP6AP1 expression varies significantly across cancer types. In TCGA data, differential ATP6AP1 expression was significant in 19 of 33 cancer types, with upregulation in 14 and downregulation in 5. When analyzing matched samples, significant differences were found in 14 of 23 cancer types . This complexity highlights the importance of cancer-specific analyses.

How can ATP6AP1 research inform the development of targeted cancer therapies?

ATP6AP1 research offers several avenues for targeted therapy development:

  • Direct targeting strategies:

    • Small molecule inhibitors of ATP6AP1-V-ATPase interaction

    • Peptide inhibitors targeting specific binding domains

    • Degraders (PROTACs) to reduce ATP6AP1 protein levels

  • Combination therapy approaches:

    • ATP6AP1 inhibition with autophagy inhibitors (demonstrated synergy in tamoxifen-resistant breast cancer)

    • V-ATPase inhibitors in ATP6AP1-overexpressing tumors

    • Immune checkpoint inhibitors for cancers where ATP6AP1 correlates with immune infiltration

  • Biomarker-based patient selection:

    • Stratify patients based on ATP6AP1 expression levels

    • Develop companion diagnostics for ATP6AP1-targeted therapies

    • Monitor ATP6AP1 levels during treatment to detect resistance mechanisms

  • Delivery considerations:

    • Design delivery systems that preferentially target cancer cells

    • Consider tumor microenvironment factors that may affect drug efficacy

    • Develop strategies to overcome potential on-target toxicities

The observation that ATP6AP1 enhances tamoxifen resistance through autophagy activation in breast cancer provides a rationale for combining autophagy inhibitors with hormonal therapies in patients with high ATP6AP1 expression .

What methods can be used to evaluate ATP6AP1 as a biomarker in preclinical cancer models?

To evaluate ATP6AP1 as a cancer biomarker in preclinical models:

  • Expression correlation studies:

    • Compare ATP6AP1 levels with established cancer phenotypes

    • Correlate expression with therapy response in PDX models

    • Evaluate expression changes during disease progression

  • Functional validation:

    • Modulate ATP6AP1 expression and assess effects on cancer hallmarks

    • Test whether ATP6AP1 levels predict drug sensitivity

    • Evaluate combinations of ATP6AP1 with other biomarkers

  • Technical validation:

    • Develop robust detection methods (IHC protocols, ELISA)

    • Establish standardized scoring systems

    • Determine threshold values for "high" vs "low" expression

  • Statistical evaluation:

    • Construct ROC curves to assess diagnostic value (AUC for ATP6AP1 in CRC: 0.855)

    • Perform multivariate analyses to control for confounding factors

    • Use nomograms to predict survival rates based on ATP6AP1 and clinicopathological factors

In colorectal cancer, ATP6AP1 expression was significantly associated with several prognostic factors, including TNM stage and patient age. Calibration curves of the nomogram showed good consistency between predicted and actual 1-, 3- and 5-year survival rates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.