Recombinant Mouse Vacuolar ATPase assembly integral membrane protein VMA21 (Vma21)

Shipped with Ice Packs
In Stock

Description

Experimental Models and Applications

Recombinant Vma21 is employed in in vitro and in vivo studies to dissect its role in disease and cellular processes.

In Vitro Models

ModelApplicationKey Findings
Mouse C2C12 myoblastsMuscle differentiation/regeneration studiesVma21-120 upregulates during differentiation; localizes to SR .
Cancer cell linesCRC (e.g., LoVo, SW620)Overexpression suppresses colony formation; knockdown promotes tumor growth .
FibroblastsX-linked myopathy (XMEA) studiesMutations impair V₀ assembly, lysosomal acidification, and lipophagy .

In Vivo Models

ModelApplicationKey Findings
XenograftsCRC tumor suppressionVma21 overexpression reduces tumor size/weight in BALB/c nude mice .
Muscle-specific KOXMEA pathogenesisLoss of Vma21-120 correlates with autophagic myopathy and lysosomal dysfunction .

V-ATPase Assembly and Lysosomal Acidification

  • V₀ Domain Assembly: Vma21 stabilizes the proteolipid ring (subunits c′, c, c″) and facilitates interaction with subunit a .

  • Lysosomal Dysfunction: Defective Vma21 leads to elevated lysosomal pH, impaired protease activation, and lipid droplet accumulation in autolysosomes .

Role in Autophagy and Lipophagy

  • Autophagy: Vma21 deficiency disrupts autolysosomal degradation, causing autophagic vacuoles in muscle (XMEA) and liver (CDG) .

  • Lipophagy: Impaired lipophagy in hepatocytes results in steatohepatitis and hypercholesterolemia .

Cancer Prognosis

  • CRC: High VMA21 expression correlates with favorable disease-specific survival (DSS) and tumor differentiation .

  • Biomarker Potential: VMA21 expression levels may predict early-stage CRC outcomes .

Clinical ParameterHigh VMA21 ExpressionLow VMA21 Expression
Tumor DifferentiationHigher gradeLower grade
DSS (CRC)Longer survivalShorter survival
AutophagyInhibited tumor growthPromoted tumor growth

Genetic Disorders

DisorderFeaturesMechanism
XMEAAutophagic myopathy, vacuolar myopathyLoss of Vma21-120 and Vma21-101; impaired SR V-ATPase function .
CDGAbnormal glycosylation, steatotic liver, hypercholesterolemiaVMA21 mutations impair V₀ assembly and lipophagy .

Unresolved Questions

  1. Isoform-Specific Functions: Distinct roles of Vma21-101 vs. Vma21-120 in muscle vs. non-muscle tissues.

  2. Therapeutic Targeting: Potential for VMA21 modulation in cancer or metabolic disorders.

  3. Mechanistic Gaps: Link between Vma21, ER stress, and cholesterol synthesis pathways .

Future Research

  • Gene Editing: CRISPR-based models to study isoform-specific contributions.

  • Translational Studies: VMA21 as a diagnostic marker in CRC or lysosomal storage diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Vma21; Vacuolar ATPase assembly integral membrane protein Vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vma21
Target Protein Sequence
MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMS NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
Uniprot No.

Target Background

Function
Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the basic function of mouse VMA21 in vacuolar ATPase assembly?

Mouse VMA21 (Vma21) is a critical assembly factor required for the proper formation of the V0 complex of vacuolar ATPase (V-ATPase). It functions as a chaperone in the endoplasmic reticulum that coordinates the assembly of V0 subunits and facilitates the transport of the assembled V0 complex into ER-derived transport vesicles . Specifically, VMA21 is essential for the interaction between the major proteolipid subunit of V0 and the 100-kDa V0 subunit (Vph1p in yeast), indicating its fundamental role in V0 assembly . Without functional VMA21, V-ATPase complex formation fails, leading to impaired lysosomal acidification and cellular dysfunction .

Methodological approach for studying this function:

  • Immunoprecipitation of VMA21 from wild-type membranes can demonstrate its association with all five V0 subunits

  • Analysis of protein-protein interactions in VMA21 knockout models reveals which specific subunit interactions are disrupted

  • Comparative analysis between wild-type and mutant cells using LysoTracker Red staining can confirm the functional impact on lysosomal acidification

What is the molecular structure and characteristics of mouse VMA21?

Mouse VMA21 is encoded by the Vma21 gene (Gene ID: 67048), which produces a small integral membrane protein of approximately 8.5 kDa. The gene has an ORF size of 306 bp . The protein spans the membrane twice with both N- and C-termini facing the cytosol, similar to its yeast homolog . Mouse VMA21 contains several alternative gene symbols including 2610030H06Rik and AI840175 .

Key structural and functional domains:

  • An ER-retention signal in the C-terminus (as observed in the yeast homolog)

  • Transmembrane domains that anchor the protein in the ER membrane

  • Protein interaction domains that facilitate binding to V0 subunits

How is VMA21 expression regulated in different tissues and developmental stages?

VMA21 shows tissue-specific expression patterns that correlate with V-ATPase demands in different cell types. In zebrafish models, vma21 expression is critical during early development, as demonstrated by the severe phenotypes observed in knockout models by 4-6 days post-fertilization (dpf) . The expression of VMA21 varies across different cell types, with notable expression in muscle, liver, and other tissues with high lysosomal activity.

Methods to analyze expression patterns:

  • Quantitative RT-PCR to measure mRNA levels across tissues and developmental stages

  • Immunohistochemistry (IHC) to visualize protein localization in tissue sections

  • Western blotting for protein quantification

  • Fluorescent reporter constructs (such as GFP-tagged VMA21) for live imaging in developmental models

What experimental models are available for studying mouse VMA21?

Several experimental models have been developed to study VMA21 function:

  • Cell culture models:

    • VMA21 overexpression systems using lentiviral vectors (pInducer 20) for gain-of-function studies

    • VMA21 knockdown using miR-30-mediated shRNAs in the PInducer10 vector for loss-of-function studies

    • Doxycycline-inducible systems for controlled expression

  • Animal models:

    • CRISPR-Cas9 engineered zebrafish with loss-of-function mutations in vma21

    • Xenograft models using VMA21-manipulated cancer cells in nude mice

  • Viral vectors for genetic manipulation:

    • AAV vectors expressing mouse VMA21 in multiple serotypes (AAV1, AAV2, AAV3, AAV5, AAV6, AAV8, AAV9, AAV-DJ)

    • Adenoviral vectors for VMA21 overexpression

How do mutations in VMA21 contribute to X-linked myopathy with excessive autophagy (XMEA)?

XMEA is characterized by proximal muscle weakness and progressive vacuolation, caused by loss-of-function mutations in VMA21. The molecular pathogenesis involves:

  • Loss of VMA21 leads to impaired V-ATPase assembly, resulting in lysosomal neutralization

  • Lysosomal dysfunction causes accumulation of autophagic vacuoles in muscle fibers

  • Aberrant autophagy signaling creates a compensatory activation of autophagy pathways

Experimental approaches to study this mechanism:

  • Analysis of lysosomal acidification using LysoTracker Red staining shows complete absence of acidic organelles in VMA21-deficient models

  • Electron microscopy reveals characteristic autophagic vacuoles with electron-dense material and naked membranes within vacuole walls

  • Western blot analysis of autophagy markers (LC3I/II) demonstrates increased LC3I and LC3II expression with decreased LC3II/LC3I ratio, indicating disrupted autophagic flux

  • Dual fluorescent LC3 reporter systems (pTol2-Ubbi:GFP-LC3-RFP-LC3ΔG) can be used to measure autophagic flux in vivo, with higher GFP:RFP ratios indicating lower flux

What are the optimal methods for measuring V-ATPase activity in the context of VMA21 manipulation?

Comprehensive assessment of V-ATPase activity requires multiple complementary approaches:

  • Lysosomal acidification measurements:

    • LysoTracker Red staining for visualizing acidic organelles in vivo

    • Ratiometric pH-sensitive dyes for quantitative measurement of lysosomal pH

    • Immunofluorescence of LAMP1 (lysosome-associated membrane protein-1) to assess lysosomal biogenesis

  • V-ATPase assembly analysis:

    • Co-immunoprecipitation of VMA21 with V0 subunits to assess proper complex formation

    • Blue Native PAGE to analyze intact V-ATPase complexes

    • Subcellular fractionation to track V0 transport from ER to lysosomes

  • Functional readouts of lysosomal activity:

    • Cathepsin activity assays (pH-dependent lysosomal enzymes)

    • Degradation assays for known lysosomal substrates

    • Electron microscopy to assess vacuolar morphology

How can researchers effectively manipulate VMA21 expression for functional studies?

Sophisticated genetic manipulation approaches for VMA21 include:

  • Inducible expression systems:

    • Doxycycline-inducible miR-30-mediated shRNAs for controlled knockdown

    • G418-inducible expression systems for controlled overexpression

    Methodology: The VMA21 cDNA sequence (NM_001017980) can be subcloned into the pENTRTM3C vector and Gateway-recombined into the pInducer 20 vector. For knockdown studies, miR-30 loop with specific shRNA targeting (e.g., 5′-CAU CUA CAC UGA AGA CGC UTT AGC GUC UUC AGU GUA GAU GTT-3′) can be subcloned into the Pinducer10 vector .

  • CRISPR-Cas9 genome editing:

    • For creating specific mutations or complete knockouts

    • Example from zebrafish model: gRNA targeted to exon 2 of vma21 generated two loss-of-function mutations:
      a) 1 bp deletion (frameshift without premature stop codon)
      b) 14 bp deletion with 21 bp insertion introducing a new stop codon

  • Viral vector delivery:

    • AAV vectors with various serotypes for tissue-specific expression

    • Adenoviral vectors for high-efficiency transient expression

    Selection criteria for serotypes: AAV9 for CNS and skeletal muscle, AAV8 for liver, AAV1/6 for muscle, AAV2 for broad tropism

What is the role of VMA21 in cancer progression and how can it be studied?

The relationship between VMA21 and cancer appears context-dependent, with evidence supporting a tumor suppressor role in colorectal cancer:

  • Expression analysis in cancer vs. normal tissues:

    • VMA21 shows significantly higher mRNA expression in colon and rectal cancerous tissues compared to adjacent normal tissues

    • Protein expression detected by IHC increases gradually from adjacent normal tissues to adenoma to primary CRC

    • Higher VMA21 expression correlates with higher differentiation grade and longer disease-specific survival (DSS) in stage I-III disease

  • Functional studies in cancer models:

    • Colony formation assays: VMA21 overexpression decreases colony numbers in SW620 and LoVo CRC cell lines

    • Xenograft models: VMA21 overexpression significantly reduces tumor size and weight in nude mice

    • Conversely, VMA21 knockdown promotes tumor development in RKO cell xenografts

  • Experimental approach to study cancer role:

    • Generate stable cell lines with inducible VMA21 expression/knockdown

    • Confirm expression changes by qRT-PCR and Western blotting

    • Assess cellular proliferation, colony formation, and in vivo tumorigenicity

    • Analyze patient samples by IHC with correlation to clinicopathological parameters

How can researchers resolve contradictory findings between VMA21's role in lysosomal function and cancer progression?

The apparent paradox that VMA21 is both essential for lysosomal function yet increased in some cancers requires sophisticated analysis:

  • Dose-dependency analysis:

    • Establish dose-response curves for VMA21 expression vs. various cellular functions

    • Use graded expression systems (e.g., tetracycline-controlled) to precisely control VMA21 levels

  • Context-specific function assessment:

    • Compare VMA21 function across different cell types and microenvironmental conditions

    • Analyze the effects of VMA21 expression in normal vs. transformed cells

  • Systems biology approach:

    • Transcriptomics, proteomics, and metabolomics to identify compensatory mechanisms

    • Network analysis to identify condition-specific interaction partners

  • Temporal dynamics:

    • Time-course experiments to distinguish acute vs. chronic effects of VMA21 manipulation

    • Pulse-chase studies to determine protein turnover rates in different contexts

What therapeutic approaches can target VMA21-dependent pathways in disease models?

The development of therapeutic strategies targeting VMA21-dependent pathways requires understanding of the molecular mechanisms and downstream effects:

  • Autophagy modulation:

    • In XMEA models, two autophagy antagonists (edaravone and LY294002) have shown efficacy in improving survival and motor function

    • In follicular lymphoma with VMA21 mutations, inhibitors of ULK1 (the proximal autophagy-regulating kinase) have demonstrated therapeutic potential

    • Cyclin-dependent kinase inhibitors have been identified as promising drugs for autophagy inhibition in this context

  • Gene therapy approaches:

    • AAV-mediated delivery of functional VMA21 shows promise for genetic disorders

    • Multiple AAV serotypes available for tissue-specific targeting

  • Small molecule screening:

    • High-throughput microscopy-based screening for autophagy-inhibiting compounds

    • Phenotypic screening using touch-evoked escape response in zebrafish models

  • Experimental design for therapeutic testing:

    • Establish clear readouts: survival analysis, behavioral analysis (e.g., touch-evoked escape response), biomarkers (LC3II/I ratio)

    • Categorize responses (low/none, medium, high responder) based on quantitative metrics

    • Implement blinded assessment to eliminate bias

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.