Recombinant Mouse Vacuole membrane protein 1 (Vmp1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its development.
Synonyms
Vmp1; Vacuole membrane protein 1; NF-E2-inducible protein 2; Protein ni-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAENGKNCDQRRIAMSKDQHNGSLTDPSSVHEKKRRDREERQNIVLWRQPLITLQYFSLE TLVVLKEWTSKLWHRQSIVVSFLLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPEEEGAEGAISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAEAAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIVTFSKHIVEQMVTFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTPQG ENWLSWMFEKLVVAMVCYFVLSIINSMAQNYAKRIQQRLNSEEKTK
Uniprot No.

Target Background

Function
Vacuole Membrane Protein 1 (VMP1) is a phospholipid scramblase involved in lipid homeostasis and membrane dynamics. It exhibits phospholipid scramblase activity towards cholesterol and phosphatidylserine, as well as phosphatidylethanolamine and phosphatidylcholine. VMP1 is essential for autophagosome formation, participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane. It re-equilibrates the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B) to facilitate autophagosome assembly. VMP1 regulates ATP2A2 activity to control ER-isolation membrane contacts for autophagosome formation. Beyond autophagy, VMP1 is involved in other processes requiring phospholipid scramblase activity. It modulates ER contacts with lipid droplets, mitochondria, and endosomes. VMP1 plays a crucial role in the formation of cell junctions. Upon stress, such as bacterial and viral infections, VMP1 promotes the formation of cytoplasmic vacuoles leading to cell death. It is involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis.
Gene References Into Functions
  1. These results indicate that miR-21a negatively modulates two tumor suppressor genes, miR-200c and PTEN, thereby promoting M2 macrophage transformation. PMID: 29359349
  2. It has been concluded that VMP1-mediated autophagy cooperates with Kras to promote pancreatic ductal adenocarcinoma initiation. PMID: 27415425
  3. VMP1 modulates SERCA2 activity to control endoplasmic reticulum contacts for autophagosome formation. PMID: 28890335
  4. AKT1-GLI3-VMP1 pathway mediates KRAS oncogene-induced autophagy in cancer cells. PMID: 22535956
  5. Zymophagy, a novel selective autophagy pathway mediated by VMP1-USP9x-p62, prevents pancreatic cell death. PMID: 21173155

Show More

Hide All

Database Links
Protein Families
VMP1 family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse VMP1?

Mouse VMP1 is an integral membrane protein consisting of 406 amino acids that contains six hydrophobic transmembrane regions. Both the N- and C-termini of VMP1 are exposed to the cytosol. The C-terminal region contains a putative ER retention signal, while the N-terminal region includes a conserved sequence with the potential to form an amphipathic alpha helix. VMP1 is primarily localized to the endoplasmic reticulum (ER) and is closely associated with markers for ER exit sites, the ER-Golgi intermediate compartment, and Golgi apparatus .

What are the primary functions of VMP1 in mouse cells?

VMP1 serves multiple critical functions in mouse cells, including:

  • Regulation of autophagy, particularly in autophagosome formation and fusion with lysosomes

  • Modulation of ER calcium levels, which impacts protein folding and cellular signaling

  • Regulation of ER-mitochondria contact sites (MAMs)

  • Maintenance of mitochondrial morphology

  • Involvement in lipid droplet formation and metabolism

  • Contribution to cellular responses against viral infections

How is VMP1 expression regulated in mouse tissues?

VMP1 expression is regulated through multiple mechanisms, including transcriptional control, post-translational modifications, and interaction with miRNAs. In particular, VMP1 expression can be modulated in response to cellular stress conditions such as ER stress, oxidative stress, and nutrient deprivation. Future research directions include further elucidation of post-translational regulations of VMP1, including ubiquitination and palmitoylation, as well as interactions with ER stress sensors that could unveil new understanding of its regulation in various tissues .

What are the most effective methods for detecting mouse VMP1 protein expression?

For detecting mouse VMP1 protein expression, researchers can employ several techniques:

  • Western blotting: Using specific anti-VMP1 antibodies to detect the protein in cell or tissue lysates. This method allows quantification of total VMP1 protein levels.

  • Immunofluorescence: For visualizing VMP1 subcellular localization, particularly its association with the ER, autophagosomes, and mitochondria.

  • Recombinant expression: Using tagged recombinant VMP1 (such as HA-tagged or GFP-fused VMP1) for tracking protein localization and interactions.

  • Flow cytometry: For quantitative assessment of VMP1 levels in different cell populations.

When using these methods, it's important to validate antibody specificity using appropriate controls, including VMP1 knockout or knockdown samples .

What are reliable approaches for generating conditional VMP1 knockout mouse models?

Generating conditional VMP1 knockout mouse models requires careful consideration due to VMP1's essential roles in cellular homeostasis. Recommended approaches include:

  • Cre-loxP system: Generate mice with loxP sites flanking critical exons of the VMP1 gene, then cross with tissue-specific Cre driver lines for conditional deletion.

  • Inducible systems: Employ tamoxifen-inducible CreERT2 systems to allow temporal control of VMP1 deletion, which is particularly important given VMP1's essential functions.

  • Alternative knockdown strategies: For more nuanced regulation, consider:

    • Doxycycline-inducible shRNA or miRNA expression systems

    • CRISPR-Cas9 with inducible or tissue-specific promoters

    • Auxin-inducible degron (AID) or conditional destabilization domain (cDD) systems for protein-level regulation

When designing these models, consider potential compensation by related proteins such as TMEM41B, which has functional overlap with VMP1 in certain contexts .

What control measures should be implemented when studying VMP1 in autophagy assays?

When studying VMP1 in autophagy assays, implement these critical controls:

  • Positive controls:

    • Starvation-induced autophagy (HBSS or serum-free media)

    • Rapamycin treatment to induce autophagy via mTOR inhibition

  • Negative controls:

    • Autophagy inhibitors (e.g., 3-methyladenine, bafilomycin A1)

    • ATG5 or ATG7 knockdown/knockout cells

  • Flux measurements:

    • Always assess autophagic flux rather than static markers alone

    • Use chloroquine or bafilomycin A1 to block lysosomal degradation

    • Monitor both LC3-I to LC3-II conversion and p62/SQSTM1 degradation

  • Multiple methods validation:

    • Combine Western blotting, immunofluorescence, and electron microscopy approaches

    • Use both GFP-LC3 puncta formation and tandem mRFP-GFP-LC3 reporters to distinguish autophagosome formation from fusion events

  • TMEM41B controls:

    • Include TMEM41B assessment due to functional overlap with VMP1

    • Consider double knockdown/knockout studies to address redundancy

How does mouse VMP1 contribute to autophagosome formation at the molecular level?

Mouse VMP1 contributes to autophagosome formation through several molecular mechanisms:

  • Isolation membrane (IM) nucleation: VMP1 facilitates the nucleation of the cup-shaped membrane known as the isolation membrane, which is the precursor to autophagosomes.

  • ATG protein recruitment: VMP1 interacts with multiple autophagy-related (ATG) proteins, helping to recruit them to autophagosome formation sites.

  • TMEM41B interaction: VMP1 works cooperatively with TMEM41B, another ER transmembrane protein, to regulate IM and autophagosome formation. This interaction is crucial for proper autophagy progression.

  • Lipid transfer: VMP1, along with TMEM41B, may function in lipid transfer during membrane expansion of the growing autophagosome.

  • ER-mitochondria contact site regulation: VMP1 modulates the contact sites between ER and mitochondria, which serve as platforms for ATG protein accumulation and autophagosome formation.

These processes are orchestrated in a highly regulated sequence involving the coordination of multiple protein complexes and membrane reorganization events .

What methodological approaches can distinguish between VMP1's roles in autophagy initiation versus autophagosome-lysosome fusion?

To differentiate VMP1's roles in autophagy initiation from autophagosome-lysosome fusion, researchers should employ these methodological approaches:

  • Temporal knockdown/knockout studies:

    • Use inducible systems to deplete VMP1 at different stages of autophagy

    • Monitor immediate effects versus long-term consequences

  • Subcellular localization analysis:

    • Perform co-localization studies of VMP1 with markers for different autophagy stages:

      • Initiation: ULK1, ATG13, FIP200

      • Phagophore formation: WIPI2, ATG16L1

      • Autophagosome completion: LC3-II

      • Fusion: LAMP1, LAMP2, STX17

  • Structure-function studies:

    • Generate domain-specific mutants of VMP1

    • Assess which domains are critical for each phase of autophagy

  • Tandem fluorescent reporters:

    • Use mRFP-GFP-LC3 to distinguish between autophagosomes (yellow) and autolysosomes (red)

    • Quantify changes in each population upon VMP1 manipulation

  • Biochemical separation techniques:

    • Isolate different autophagy-related structures using density gradient centrifugation

    • Analyze the presence of VMP1 in different fractions

  • Live-cell imaging:

    • Track autophagosome formation and fusion events in real-time using fluorescently tagged proteins

    • Measure kinetics in the presence/absence of VMP1

How can researchers differentiate between direct and indirect effects of VMP1 on autophagy in experimental models?

Differentiating between direct and indirect effects of VMP1 on autophagy requires sophisticated experimental designs:

  • Acute versus chronic VMP1 depletion:

    • Use fast-acting degradation systems (e.g., auxin-inducible degron) for acute depletion

    • Compare with long-term knockout phenotypes

    • Immediate effects (minutes to hours) likely represent direct functions

  • Rescue experiments:

    • Perform domain-specific complementation assays

    • Test whether specific VMP1 mutants can rescue autophagy defects

    • Include TMEM41B overexpression to assess functional redundancy

  • Proximity-dependent labeling:

    • Use BioID or APEX2 fused to VMP1 to identify direct interaction partners

    • Validate interactions with co-immunoprecipitation and FRET/BRET assays

  • In vitro reconstitution:

    • Develop cell-free systems to test direct biochemical activities

    • Assess membrane remodeling capabilities using purified components

  • Compensation analysis:

    • Profile transcriptional and translational changes after VMP1 depletion

    • Identify and control for secondary adaptations that may mask direct effects

  • Time-course studies:

    • Analyze temporal dynamics of various autophagy markers after VMP1 manipulation

    • Earlier effects are more likely to be direct consequences

How is mouse VMP1 dysregulation linked to neurodegenerative disease models?

VMP1 dysregulation has significant implications in mouse models of neurodegenerative diseases:

  • Parkinson's disease models:

    • VMP1 dysfunction contributes to impaired mitophagy (autophagy of mitochondria)

    • This leads to accumulation of damaged mitochondria and increased oxidative stress

    • VMP1 may interact with PINK1/Parkin pathways that are critical for mitochondrial quality control

  • Alzheimer's disease connections:

    • VMP1-mediated disruption of ER calcium homeostasis affects neuronal function

    • Impaired autophagy due to VMP1 dysfunction can lead to accumulated protein aggregates

    • ER-mitochondria contact sites regulated by VMP1 are altered in AD models

  • Mechanistic insights:

    • VMP1 depletion causes increased ER-mitochondria contacts from 5.9% to 19% of mitochondrial membrane

    • Formation of ER-mitochondria tethering complexes is markedly increased in VMP1-depleted cells

    • Altered mitochondrial morphology (inflated or absent cristae) occurs in VMP1-deficient cells

  • Therapeutic implications:

    • Modulating VMP1 activity could potentially restore autophagy function and mitigate disease progression

    • Targeting VMP1-regulated pathways may offer novel therapeutic approaches for neurodegenerative diseases

What experimental approaches can be used to investigate VMP1's role in inflammation and cancer models?

To investigate VMP1's role in inflammation and cancer models, consider these experimental approaches:

  • Inflammation studies:

    • Generate myeloid-specific VMP1 conditional knockout mice

    • Assess inflammatory responses in various disease models (e.g., LPS challenge, DSS-induced colitis)

    • Measure cytokine production and inflammatory cell infiltration

    • Evaluate inflammasome activation and pyroptosis

  • Cancer model approaches:

    • Create tissue-specific inducible VMP1 knockout in cancer-prone tissues

    • Employ orthotopic and xenograft tumor models with VMP1 manipulation

    • Analyze tumor initiation, progression, and metastasis

    • Assess therapies targeting VMP1-related pathways

  • Mechanistic investigations:

    • Examine the relationship between VMP1-mediated autophagy and inflammation

    • Study ER stress responses and unfolded protein response activation

    • Investigate lipid metabolism alterations in cancer cells

    • Assess calcium signaling perturbations

  • Translational methodologies:

    • Analyze VMP1 expression in patient-derived xenografts

    • Correlate VMP1 levels with tumor stage, grade, and patient outcomes

    • Develop biomarkers based on VMP1 status for disease monitoring

    • Test combination therapies targeting VMP1-regulated pathways

How can researchers effectively use recombinant mouse VMP1 protein for structure-function studies?

For effective structure-function studies of recombinant mouse VMP1:

  • Protein expression strategies:

    • Use mammalian expression systems (HEK293, CHO cells) for proper folding and post-translational modifications

    • Consider insect cell systems (Sf9, High Five) for higher yields

    • Design constructs with removable tags (His, GST, MBP) for purification

    • Include TEV or PreScission protease sites for tag removal

  • Domain analysis approaches:

    • Generate truncated constructs to analyze individual domains

    • Create chimeric proteins swapping domains with related proteins (e.g., TMEM41B)

    • Introduce site-specific mutations in conserved residues

    • Use alanine-scanning mutagenesis for functional surface mapping

  • Structural biology methods:

    • Apply cryo-electron microscopy for membrane protein structure determination

    • Use NMR for dynamic studies of soluble domains

    • Perform hydrogen-deuterium exchange mass spectrometry for conformational analysis

    • Implement cross-linking mass spectrometry to map interaction interfaces

  • Functional reconstitution:

    • Reconstitute purified VMP1 into liposomes for membrane activity assays

    • Develop in vitro lipid transfer assays

    • Assess calcium transport capabilities

    • Measure effects on membrane curvature and deformation

What are the most promising approaches for studying VMP1-TMEM41B interactions in mouse models?

For studying VMP1-TMEM41B interactions in mouse models, these approaches show the most promise:

  • Genetic manipulation strategies:

    • Generate double conditional knockout mouse models for both proteins

    • Create knock-in mouse lines expressing tagged versions for in vivo tracking

    • Develop domain-swap mutants to identify interaction regions

    • Implement CRISPR-based scarless tagging for endogenous protein tracking

  • Biochemical interaction analysis:

    • Perform co-immunoprecipitation from tissue samples

    • Use proximity ligation assays in tissue sections

    • Implement split-protein complementation systems (e.g., split-GFP)

    • Apply FRET/FLIM imaging in primary cells and tissues

  • Functional cooperation assessment:

    • Compare phenotypes of single versus double knockouts

    • Test rescue capabilities through complementation studies

    • Analyze compensatory changes in expression levels

    • Examine lipid droplet accumulation patterns, which occur when either protein is depleted

  • Systems biology approaches:

    • Perform transcriptomics and proteomics on tissues from various knockout models

    • Create protein-protein interaction networks

    • Implement computational modeling of cooperative functions

    • Use tissue-specific interactome analysis

What methodological challenges exist when investigating VMP1's role in ER-mitochondria contacts, and how can they be addressed?

Investigating VMP1's role in ER-mitochondria contacts presents several methodological challenges with corresponding solutions:

  • Challenge: Distinguishing direct from indirect effects on contact sites
    Solutions:

    • Use acute depletion systems (AID, cDD) to observe immediate consequences

    • Implement direct targeting of VMP1 to contact sites using synthetic biology approaches

    • Employ in vitro reconstitution with purified components to test direct effects

  • Challenge: Quantifying dynamic contact site changes
    Solutions:

    • Implement high-resolution live-cell imaging with split fluorescent proteins

    • Use electron microscopy with stereological analysis for precise quantification

    • Apply super-resolution microscopy (STED, STORM) with automated image analysis

    • Measure functional readouts like calcium transfer or lipid movement between organelles

  • Challenge: Determining tissue-specific variations in VMP1 function
    Solutions:

    • Generate tissue-specific knockout models with appropriate controls

    • Isolate primary cells from different tissues for ex vivo analysis

    • Use tissue-specific promoters for manipulation in select cell populations

    • Develop organoid models to maintain tissue architecture

  • Challenge: Separating VMP1's effects on contact sites from its other functions
    Solutions:

    • Create domain-specific mutants that selectively affect different functions

    • Use tethering proteins to artificially maintain contacts despite VMP1 manipulation

    • Employ compensatory approaches that rescue specific functions

    • Develop mathematical models to deconvolute multiple effects

What are the key experimental parameters for generating and validating recombinant mouse VMP1?

Table 1: Optimization Parameters for Recombinant Mouse VMP1 Production

Expression SystemTag OptionsRecommended Purification MethodTypical YieldValidation MethodsCommon Issues
HEK293T cellsC-terminal His6IMAC followed by SEC0.5-1 mg/LWestern blot, Mass spectrometryAggregation during concentration
CHO cellsN-terminal FLAGAnti-FLAG affinity chromatography1-2 mg/LFunctional assays, Western blotGlycosylation heterogeneity
Sf9 insect cellsN-terminal GSTGlutathione affinity purification2-5 mg/LSDS-PAGE, SEC-MALSIncomplete solubilization
E. coli (membrane fractions)C-terminal GFPFluorescence-based detection0.1-0.3 mg/LMicroscopy, Fluorescence-SECPoor folding, inclusion bodies
Cell-free systemSplit-VenusDirect visualizationVariableFluorescence complementationLow yield, high cost

Key considerations:

  • For structural studies, mammalian or insect cell expression is strongly recommended over bacterial systems

  • Detergent selection is critical: mild detergents (DDM, LMNG) preserve function better than harsher alternatives

  • Consider using nanodiscs or amphipols for stabilizing the purified protein

  • N-terminal tags generally perform better than C-terminal tags due to the importance of the C-terminal region for function

What phenotypic changes are observed in different VMP1 knockout/knockdown models?

Table 2: Comparative Phenotypes in VMP1 Depletion Models

Model SystemDepletion MethodAutophagy ChangesER-Mitochondria EffectsCellular MorphologyPhysiological Outcome
Mouse embryonic fibroblastsCRISPR knockoutBlocked autophagosome formationIncreased contact sites (>3-fold)Swollen ER, abnormal mitochondriaCell death within 72 hours
HeLa cellssiRNA knockdownReduced LC3-II/I ratio, p62 accumulationER-mitochondria contacts doubledEnlarged ER, fragmented GolgiGrowth inhibition, increased ER stress
Primary neuronsConditional knockoutImpaired mitophagyEnhanced Ca2+ transfer to mitochondriaSpherical mitochondria with absent cristaeNeurite retraction, increased apoptosis
Mouse liver (in vivo)AAV-Cre deliveryAccumulated autophagic substratesAltered MAM compositionLipid droplet accumulationHepatic steatosis, inflammation
Mouse pancreas (in vivo)Pdx1-Cre knockoutImpaired zymophagyDysregulated Ca2+ signalingAcinar cell vacuolizationPancreatitis-like phenotype
T. gondii parasitesAuxin-inducible degronN/AN/AImpaired rhoptry biogenesisDefects in gliding motility, invasion, and egress

Research implications:

  • Phenotypic severity correlates with depletion efficiency and duration

  • Compensatory mechanisms (especially TMEM41B upregulation) may emerge in partial knockdown models

  • Tissue-specific effects highlight contextual functions of VMP1

  • Early effects (0-24h) typically involve autophagy and ER-mitochondria contacts

  • Late effects (>48h) often reflect secondary consequences and adaptive responses

What are the key interaction partners of mouse VMP1 and their functional significance?

Table 3: VMP1 Protein Interaction Network and Functional Implications

Interaction PartnerDetection MethodInteraction DomainFunctional SignificanceResearch Applications
TMEM41BCo-IP, PLA, BioIDTransmembrane domainsCooperative regulation of autophagosome formationTarget for combined manipulation in autophagy studies
BECN1/Beclin-1Co-IP, Y2HC-terminal regionRecruitment of class III PI3K complexMarker for early autophagy initiation events
SERCA2Proximity labeling, Co-IPTransmembrane domainsRegulation of ER calcium homeostasisTarget for calcium signaling studies
Mitofusin 2 (MFN2)Co-IP, FRETN-terminal regionModulation of ER-mitochondria contactsTool for studying organelle communication
ATG14Co-IP, MicroscopyC-terminal regionAutophagosome formationMarker for phagophore assembly
VAPA/BBioID, Co-IPTransmembrane domainsER-mitochondria tethering regulationTarget for membrane contact site studies
ULK1 complexProximity labelingN-terminal regionEarly autophagy inductionIndicator of autophagy initiation
EPG5Y2H, Co-IPC-terminal regionAutophagosome-lysosome fusionMarker for late-stage autophagy events

Research applications:

  • These interactions provide targets for specific intervention in VMP1-dependent pathways

  • Differential interactions in various tissues may explain context-specific functions

  • Targeting specific interactions rather than VMP1 itself may allow more nuanced experimental manipulation

  • Intersection with disease-associated proteins offers potential therapeutic avenues

What are the most promising future research directions for mouse VMP1 studies?

The most promising future research directions for mouse VMP1 studies include:

  • Structural biology advances:

    • Determining high-resolution structures of VMP1 alone and in complex with key partners

    • Elucidating the conformational changes during different functional states

    • Mapping critical domains for various functions

  • Physiological roles in specific tissues:

    • Investigating tissue-specific functions using conditional knockout approaches

    • Examining VMP1's role in specialized cell types (neurons, immune cells, etc.)

    • Understanding compensatory mechanisms that emerge in different tissues

  • Disease-specific investigations:

    • Further characterizing VMP1's role in neurodegenerative diseases

    • Exploring its contribution to inflammatory conditions

    • Investigating potential as a biomarker or therapeutic target

  • Regulatory mechanisms:

    • Elucidating post-translational modifications (ubiquitination, palmitoylation, etc.)

    • Understanding interactions with miRNAs and ER stress sensors

    • Mapping signaling pathways that modulate VMP1 activity

  • Technological innovations:

    • Developing tools for acute and reversible VMP1 manipulation in vivo

    • Creating biosensors to monitor VMP1 activity in real-time

    • Implementing organoid and tissue-specific models to study VMP1 function

How can researchers integrate VMP1 studies with emerging technologies in cell biology?

Researchers can integrate VMP1 studies with emerging technologies in these innovative ways:

  • Advanced imaging approaches:

    • Implement lattice light-sheet microscopy for long-term live imaging of VMP1 dynamics

    • Apply correlative light and electron microscopy (CLEM) to connect VMP1 localization with ultrastructural features

    • Use expansion microscopy to visualize VMP1 distribution at nanoscale resolution

  • Genome editing technologies:

    • Apply base editing for introducing specific point mutations in endogenous VMP1

    • Implement prime editing for precise modifications without double-strand breaks

    • Use CRISPR activation/inhibition for temporally controlled endogenous regulation

  • Single-cell technologies:

    • Perform single-cell transcriptomics to identify cell-specific responses to VMP1 manipulation

    • Apply spatial transcriptomics to map VMP1-dependent gene expression changes in tissue context

    • Implement multiomics approaches to correlate transcriptional, proteomic, and metabolic changes

  • Artificial intelligence integration:

    • Develop machine learning algorithms for automated analysis of VMP1 localization and dynamics

    • Use AI-based protein structure prediction to model VMP1 interactions

    • Implement systems biology approaches to model VMP1's role in cellular networks

  • Organoid and microphysiological systems:

    • Create organ-specific models to study VMP1 in physiologically relevant contexts

    • Develop multi-organ-on-chip systems to examine systemic effects of VMP1 dysfunction

    • Implement patient-derived organoids to study disease-specific VMP1 alterations

What are common technical challenges when working with recombinant mouse VMP1 and how can they be addressed?

Common technical challenges with recombinant mouse VMP1 and their solutions include:

  • Protein aggregation and insolubility:

    • Challenge: As a transmembrane protein, VMP1 tends to aggregate during purification.

    • Solutions:

      • Use mild detergents like LMNG or DDM rather than harsh detergents

      • Add stabilizing agents such as glycerol (10-15%) or specific lipids

      • Consider nanodiscs or amphipol reconstitution for increased stability

      • Optimize buffer conditions (pH 7.2-7.5 tends to work best)

      • Maintain low protein concentration during purification steps

  • Non-specific antibody binding:

    • Challenge: Commercial antibodies often show cross-reactivity or poor specificity.

    • Solutions:

      • Validate antibodies using VMP1 knockout/knockdown samples as negative controls

      • Consider developing custom monoclonal antibodies against specific epitopes

      • Use epitope-tagged recombinant VMP1 constructs when possible

      • Implement stringent blocking and washing conditions for immunoblotting

  • Confounding effects of overexpression:

    • Challenge: Overexpressed VMP1 may cause ER stress and non-physiological effects.

    • Solutions:

      • Use inducible expression systems with titratable expression levels

      • Aim for expression levels close to endogenous (validate by Western blot)

      • Consider CRISPR knock-in approaches for tagging endogenous VMP1

      • Include appropriate empty vector controls

  • Compensation by related proteins:

    • Challenge: TMEM41B can compensate for VMP1 loss, confounding results.

    • Solutions:

      • Monitor TMEM41B expression levels in VMP1 manipulation experiments

      • Consider double knockdown/knockout approaches

      • Use acute depletion systems to minimize compensatory responses

      • Implement domain-specific mutations rather than complete protein removal

How can researchers interpret contradictory results in VMP1 autophagy studies?

When faced with contradictory results in VMP1 autophagy studies, researchers should consider these interpretation strategies:

  • Cell type and context differences:

    • Analysis approach: Compare exact experimental conditions, including cell types, growth conditions, and confluency levels

    • Resolution strategy: Perform side-by-side experiments in multiple cell types to establish context-dependent effects

    • Validation method: Use primary cells or tissue samples to confirm relevance to in vivo contexts

  • Acute versus chronic VMP1 depletion:

    • Analysis approach: Compare the timing and extent of VMP1 depletion across studies

    • Resolution strategy: Conduct time-course experiments to distinguish immediate versus adaptive responses

    • Validation method: Implement both inducible knockdown and constitutive knockout approaches to differentiate temporal effects

  • Methodology variations:

    • Analysis approach: Examine differences in autophagy detection methods across studies

    • Resolution strategy: Apply multiple complementary techniques within a single study (western blot, imaging, electron microscopy)

    • Validation method: Include positive controls (starvation, rapamycin) and negative controls (ATG5/7 knockdown)

  • Differential VMP1 functions:

    • Analysis approach: Consider whether studies are examining different aspects of VMP1 function

    • Resolution strategy: Design experiments that specifically isolate particular VMP1 functions

    • Validation method: Use domain-specific mutations to separate VMP1's roles in autophagy, calcium regulation, and membrane contacts

  • Experimental rigor considerations:

    • Analysis approach: Evaluate statistical approaches, sample sizes, and replication strategies

    • Resolution strategy: Implement blinded analysis and increased biological replicates

    • Validation method: Collaborate with independent laboratories to confirm key findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.