Recombinant Mouse Very long-chain acyl-CoA synthetase (Slc27a2)

Shipped with Ice Packs
In Stock

Description

Introduction and Basic Characteristics

Very Long-Chain Acyl-CoA Synthetase (Slc27a2), also known as Fatty Acid Transport Protein 2 (FATP2) or Acsvl1, belongs to the solute carrier family 27 of proteins. This enzyme plays a critical role in fatty acid metabolism, particularly in the liver, by facilitating the transport of fatty acids across cellular membranes and catalyzing the activation of very long-chain fatty acids through CoA esterification . The protein is part of a larger family that includes six members of very long-chain acyl-CoA synthetases (ACSVL), which have been designated as fatty acid transport proteins due to their presumed role in cellular fatty acid uptake .

Protein Structure

While the search results don't provide specific details about mouse Slc27a2 structure, the human ortholog SLC27A2 consists of 620 amino acids with three transmembrane domains . The mouse protein likely shares significant structural similarities given the conservation of this protein family across mammalian species. The protein contains highly conserved motifs characteristic of acyl-CoA synthetases, which are essential for its enzymatic function .

Enzymatic Activity

Slc27a2 possesses dual enzymatic capabilities:

  1. Very long-chain acyl-CoA synthetase activity: It catalyzes the ATP-dependent activation of very long-chain fatty acids by forming thioester bonds with coenzyme A.

  2. Fatty acid transport: It facilitates the movement of fatty acids across cellular membranes, although this function has been debated for some members of the FATP family .

The enzyme demonstrates substrate preferences, being capable of activating both long-chain (C16:0) and very long-chain (C24:0) fatty acids, similar to other members of its family . This activity is crucial for channeling fatty acids toward metabolic pathways such as β-oxidation or lipid synthesis.

Tissue Distribution

Slc27a2 exhibits a tissue-specific expression pattern in mice. RNA-seq data from mouse kidney analysis reveals significant expression of Slc27a2, where it is classified as "solute carrier family 27 (fatty acid transporter), member 2" . The expression data indicates substantial presence in kidney tissue with transcripts per million (TPM) values of 4620.1 in whole kidney samples .

Expression Data Table

The following table summarizes Slc27a2 expression data from mouse kidney RNA-seq analysis:

Gene SymbolGene DescriptionWhole Kidney (TPM)Proximal Tubule (TPM)Thick Ascending Limb (TPM)Distal Convoluted Tubule (TPM)
Slc27a2Solute carrier family 27 (fatty acid transporter), member 24620.19165.672.1141.8

This expression profile reveals that Slc27a2 is highly enriched in proximal tubules (1.98-fold higher than whole kidney), while expression is significantly lower in thick ascending limbs (0.02-fold) and distal convoluted tubules (0.03-fold) . This pattern suggests a specialized role for Slc27a2 in proximal tubule function within the kidney.

Metabolic Functions

Slc27a2 functions as a peroxisomal very long-chain acyl-CoA synthetase and hepatic fatty acid transporter . Its primary roles include:

  1. Activation of fatty acids by catalyzing the formation of fatty acyl-CoA esters

  2. Facilitation of fatty acid transport across cellular membranes

  3. Contribution to peroxisomal β-oxidation of very long-chain fatty acids

  4. Participation in lipid biosynthetic pathways

These functions position Slc27a2 as a crucial enzyme at the intersection of multiple lipid metabolic pathways, influencing both catabolic and anabolic processes.

Regulation of Gene Expression

Research indicates that Slc27a2 expression is regulated by metabolic factors and transcription regulators, particularly Peroxisome Proliferator-Activated Receptor alpha (PPARα). Studies have shown that deletion of Slc27a2 (FATP2) in mouse liver changes the metabolic landscape by increasing the expression of PPARα-regulated genes . This suggests a complex regulatory relationship where Slc27a2 both influences and is influenced by PPARα signaling pathways.

Hepatic Functions

The liver is a major site of Slc27a2 expression and activity, where it plays a pivotal role in lipid metabolism. Research demonstrates that FATP2 (Slc27a2, Acsvl1) significantly impacts hepatic lipid homeostasis through its involvement in fatty acid uptake and activation .

Impact of FATP2 Deletion

Studies on FATP2 deletion in mouse liver have provided valuable insights into its physiological significance. When FATP2 is deleted:

  1. Changes occur in the hepatic metabolic landscape

  2. Expression of PPARα-regulated genes increases

  3. Alterations in lipid metabolism pathways are observed

These findings underline the importance of Slc27a2 in maintaining normal liver function and metabolic balance . The complex interplay between Slc27a2 activity and PPARα signaling represents a key regulatory mechanism in hepatic metabolism.

Recombinant Protein Technology

While specific information about recombinant mouse Slc27a2 production is limited in the provided search results, recombinant protein technology generally involves the expression of a gene of interest in host cells to produce functional proteins for research and therapeutic applications. The search results do mention recombinant human SLC27A2 (partial) being commercially available , suggesting similar approaches are likely used for mouse Slc27a2 production.

Research Applications

Recombinant Slc27a2 serves several important research applications:

  1. Functional Studies: Investigating enzymatic properties, substrate specificity, and kinetic parameters

  2. Structural Analysis: Determining protein structure-function relationships

  3. Drug Discovery: Screening for inhibitors or modulators of Slc27a2 activity

  4. Antibody Production: Generating specific antibodies for detection and localization studies

  5. Metabolic Research: Studying the role of Slc27a2 in lipid metabolism and related disorders

These applications contribute to our understanding of fatty acid metabolism and may lead to therapeutic interventions for metabolic disorders.

Key Research Discoveries

Several significant findings regarding Slc27a2 have emerged from research:

  1. Slc27a2 functions as both a fatty acid transporter and very long-chain acyl-CoA synthetase

  2. It plays a pivotal role in hepatic lipid metabolism

  3. Expression is highly enriched in kidney proximal tubules, suggesting specialized functions in this tissue

  4. Deletion of Slc27a2 affects PPARα-regulated gene expression, indicating regulatory interconnections with key metabolic pathways

Clinical and Physiological Relevance

The role of Slc27a2 in lipid metabolism suggests potential implications for various metabolic conditions:

Understanding the functional roles of Slc27a2 could provide insights into the pathophysiology of these conditions and potential therapeutic approaches.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements regarding the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc27a2; Acsvl1; Facvl1; Fatp2; Vlacs; Vlcs; Very long-chain acyl-CoA synthetase; VLACS; VLCS; Arachidonate--CoA ligase; Fatty acid transport protein 2; FATP-2; Fatty-acid-coenzyme A ligase, very long-chain 1; Long-chain-fatty-acid--CoA ligase; Phytanate--CoA ligase; Solute carrier family 27 member 2; THCA-CoA ligase; Very long-chain-fatty-acid-CoA ligase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRYFLRLANMARRVRSYRQRRPVRTILRAFL EQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQLGLRQGDCVALFMGNEPAYVWI WLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEVLPTLKKDAVSVF YVSRTSNTNGVDTILDKVDGVSAEPTPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHH RLWYGTGLAMSSGITAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDD CRKYNVTVIQYIGELLRYLCNTPQKPNDRDHKVKKALGNGLRGDVWREFIKRFGDIHVYE FYASTEGNIGFVNYPRKIGAVGRANYLQRKVARYELIKYDVEKDEPVRDANGYCIKVPKG EVGLLVCKITQLTPFIGYAGGKTQTEKKKLRDVFKKGDIYFNSGDLLMIDRENFVYFHDR VGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASLKIKENYEFNGK KLFQHIAEYLPSYARPRFLRIQDTIEITGTFKHRKVTLMEEGFNPTVIKDTLYFMDDAEK TFVPMTENIYNAIIDKTLKL
Uniprot No.

Target Background

Function
Very long-chain acyl-CoA synthetase (VLCS) is an enzyme that activates long-chain and very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. It can also activate branched-chain fatty acids such as phytanic acid and pristanic acid. VLCS does not activate C24 bile acids, cholate, and chenodeoxycholate. In vitro, it activates 3-alpha,7-alpha,12-alpha-trihydroxy- 5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. VLCS exhibits long-chain fatty acids (LCFA) transport activity and plays a significant role in hepatic fatty acid uptake.
Gene References Into Functions
  1. Contractile strength in FATP2-knockdown gallbladders was significantly greater than in control gallbladders following lithogenic diet administration. FATP2-knockdown significantly reduced gallbladder triacylglycerol. PMID: 27033116
  2. In mice, Grassofermata decreased absorption of (13)C-oleate, demonstrating its potential as a therapeutic agent. PMID: 26284975
  3. Although hypoxia regulates the expression of FATP2 and FATP4 in human trophoblasts, mouse Fatp2 and Fatp4 are not essential for intrauterine fetal growth. PMID: 22028793
  4. FATP2 is a multifunctional protein that exhibits subcellular localization-dependent activity and is a major contributor to peroxisomal (V)LACS activity. PMID: 20530735
  5. The mouse VLCS gene (Vlcs) encodes an enzyme (Vlcs) with VLCS activity that localizes to peroxisomes and is expressed in X-ALD target tissues. PMID: 12048192
  6. PPARalpha up-regulates the expression of Slc27a2 in the small intestine. PMID: 17978498

Show More

Hide All

Database Links
Protein Families
ATP-dependent AMP-binding enzyme family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Peroxisome membrane; Peripheral membrane protein. Cell membrane; Multi-pass membrane protein. Microsome.
Tissue Specificity
Strong expression in liver and kidney (at protein level). Lower expression in brain and testis, no expression in skeletal muscle and spleen. Shows uniform distribution in liver acinus.

Q&A

What is Slc27a2 and what are its primary functions?

Slc27a2 (Solute Carrier Family 27 Member 2) is a protein that functions as a very long-chain acyl-CoA synthetase, also known as Fatty Acid Transport Protein 2 (FATP2). It plays crucial roles in fatty acid metabolism, particularly in the activation and transport of long-chain and very long-chain fatty acids. The protein catalyzes the formation of fatty acyl-CoA esters from fatty acids, ATP, and CoA through the enzymatic activity EC:6.2.1.3 (Long-chain-fatty-acid--CoA ligase) . This activation is an essential step for fatty acids to participate in various metabolic pathways including β-oxidation, lipid synthesis, and cell signaling processes.

What gene synonyms and alternative protein names should researchers be aware of when researching Slc27a2?

When conducting literature searches or database inquiries, researchers should be aware of the following alternative nomenclature:

Gene synonyms:

  • Acsvl1

  • Facvl1

  • Fatp2

  • Vlacs

  • Vlcs

Protein name synonyms:

  • Very long-chain acyl-CoA synthetase

  • Fatty acid transport protein 2

  • FATP-2

  • Fatty-acid-coenzyme A ligase, very long-chain 1

  • Long-chain-fatty-acid--CoA ligase

  • THCA-CoA ligase

  • Very long-chain-fatty-acid-CoA ligase

Understanding these synonyms is critical for comprehensive literature reviews and to avoid overlooking relevant research findings.

How does Slc27a2 expression vary across different tissues in mice?

Slc27a2 is predominantly expressed in metabolically active tissues. While the provided search results don't detail the complete tissue expression profile, research has established that this protein is highly expressed in the liver and kidney, with significant expression also found in the intestine and pancreatic cells. The differential expression across tissues correlates with its functional roles in lipid metabolism and may help explain tissue-specific phenotypes observed in knockout models . Researchers should consider these expression patterns when designing tissue-specific studies or interpreting experimental results.

How does Slc27a2 deletion affect diabetic kidney disease progression in mouse models?

Genetic deletion of Slc27a2 in diabetic-prone mouse models demonstrates remarkable protective effects against diabetic kidney disease (DKD) progression. Studies using Lepr^db/db eNOS^-/- mice (a genetic model of DKD) crossed with Slc27a2^-/- mice revealed:

  • Normalization of glomerular filtration rate

  • Reduced albuminuria

  • Improved kidney histopathology

  • Extended life span compared to diabetic mice with functional Slc27a2

The mechanism appears to involve protection against lipotoxicity from albumin-bound fatty acids that are filtered across damaged glomeruli and reabsorbed by proximal tubules through FATP2-dependent mechanisms. These findings suggest that FATP2 inhibition could represent a therapeutic approach for preventing or treating DKD .

What is the relationship between Slc27a2 expression and glycemic control in diabetes models?

Slc27a2 deletion has profound effects on glycemic control in diabetic mouse models. Research demonstrates:

  • DKD-prone Slc27a2^-/- mice exhibit markedly reduced fasting plasma glucose levels, approaching euglycemia despite increased obesity and decreased physical activity

  • A linear relationship exists between plasma glucose levels and Slc27a2 null allele number in Lepr^db/db eNOS^-/- mice (R^2 = 0.996)

  • The glucose-lowering effect is not mediated through enhanced urinary glucose excretion (glycosuria)

The mechanism involves β-cell preservation, as Slc27a2^-/- mice maintain normal insulin levels despite diabetogenic conditions. Histological examination reveals larger pancreatic islets with more β-cells in Slc27a2^-/- Lepr^db/db eNOS^-/- mice compared to their Slc27a2^+/+ counterparts .

What role does Slc27a2 play in cancer progression, specifically in renal cell carcinoma?

Recent research has identified Slc27a2 as a potential tumor suppressor in clear cell renal cell carcinoma (ccRCC). Key findings include:

These findings suggest SLC27A2 could serve as both a prognostic biomarker and a potential therapeutic target in ccRCC. The ROC curve analysis supports its potential utility as a diagnostic biomarker for ccRCC (p = 0.0067 and p < 0.0001 in different datasets) .

What are the optimal methods for generating Slc27a2 knockout mouse models?

Based on published research methodologies, the established approach for generating Slc27a2 knockout mice involves:

  • Obtaining 129S-Slc27a2^tm1Kds/J mice from repositories such as Jackson Laboratory

  • Backcrossing for at least 10 generations with the desired genetic background (e.g., C57BLKS/J) to create a congenic strain

  • Intercrossing heterozygous mice to generate experimental knockout groups

  • Confirming genotypes via PCR analysis

For studies examining Slc27a2's role in specific disease models, researchers should consider breeding these knockout mice with established disease models (e.g., Lepr^db/db eNOS^-/- for DKD studies) and carefully characterizing the resulting phenotypes across multiple parameters .

What experimental designs are most effective for studying Slc27a2 function in metabolic disorders?

Effective experimental designs for studying Slc27a2 function in metabolic disorders include:

  • Genetic approaches:

    • Global Slc27a2 knockout models

    • Tissue-specific conditional knockout models

    • Gene dose studies comparing heterozygous and homozygous knockouts

  • Inducible disease models:

    • High-fat diet (HFD) feeding (e.g., Teklad TD.06414, 60.3% fat, 21.3% carbohydrate, 18.4% protein)

    • Low-dose streptozotocin (STZ) treatment (e.g., 65 μg/g daily for 3 days)

    • Combination of HFD and STZ to induce type 2 diabetes and DKD

  • Key measurements:

    • Blood glucose monitoring (fasting conditions)

    • Insulin secretion assays

    • Food consumption and physical activity tracking

    • Histopathological analysis of relevant tissues

    • Molecular markers of disease progression

Multiple experimental groups should be included to isolate the specific effects of Slc27a2 deletion from other variables in the model systems.

What cell culture systems are appropriate for studying Slc27a2 function in vitro?

For in vitro studies of Slc27a2 function, researchers have successfully employed:

  • Cell lines:

    • Renal cancer cell lines (786-O and Caki) have been validated for Slc27a2 functional studies

    • Pancreatic β-cell lines for studies on insulin secretion

    • Hepatocyte and kidney cell lines for metabolic studies

  • Genetic manipulation approaches:

    • Lentiviral vectors for Slc27a2 overexpression

    • siRNA for Slc27a2 knockdown

  • Functional assays:

    • Cell proliferation assays (e.g., CCK8)

    • Migration and invasion assays

    • Metabolic flux analysis for fatty acid metabolism

    • Insulin secretion assays in pancreatic cell models

When designing in vitro experiments, researchers should verify endogenous Slc27a2 expression levels in their chosen cell line to ensure relevance to the research question.

How should researchers interpret contradictory findings regarding Slc27a2 function in different tissues?

When encountering contradictory findings regarding Slc27a2 function, researchers should consider:

  • Tissue-specific effects: Slc27a2 may have different or even opposing functions in different tissues. For example, while its deletion appears protective in kidney tissue in DKD models, it may have different effects in liver or adipose tissue.

  • Context-dependency: The function of Slc27a2 may differ significantly depending on pathological context. For instance, its role in normal physiology may differ from its role in diabetic conditions or cancer.

  • Methodological differences: Contradictions may arise from differences in:

    • Animal models (strain, age, sex)

    • Experimental conditions (diet, housing, duration)

    • Measurement techniques and timepoints

  • Compensatory mechanisms: In knockout models, other fatty acid transporters may compensate for Slc27a2 absence, potentially obscuring or altering the observed phenotype .

To resolve contradictions, researchers should design experiments that directly compare conditions within a single study and consider using conditional or inducible knockout models to minimize compensatory adaptations.

What statistical approaches are most appropriate for analyzing Slc27a2 expression data in cancer studies?

Based on published methodologies, the following statistical approaches are recommended:

  • For comparing expression levels between groups:

    • Two-group comparisons: Unpaired two-tailed t-test

    • Multiple group comparisons: One-way ANOVA with Tukey's test for multiple testing of nonparametric data

  • For survival analysis:

    • Kaplan-Meier curves with log-rank tests to compare survival outcomes

    • Cox proportional hazards regression for univariate and multivariate analyses to identify independent predictors

  • For diagnostic value assessment:

    • Receiver Operating Characteristic (ROC) curve analysis to evaluate sensitivity and specificity

    • Area Under the Curve (AUC) calculation to quantify diagnostic performance

  • For gene dose effects:

    • Linear regression analysis to determine relationships between phenotypes and Slc27a2 null allele number

Statistical significance is typically defined as p < 0.05, and researchers should report both the test statistic and exact p-values rather than simply stating significance.

What are the most promising therapeutic applications targeting Slc27a2?

Based on current research findings, the most promising therapeutic applications targeting Slc27a2 include:

  • Diabetic kidney disease treatment:

    • FATP2 inhibitors may protect against lipotoxicity in proximal tubule cells

    • This approach could potentially slow DKD progression to end-stage renal disease

  • Glycemic control in diabetes:

    • FATP2 inhibition might preserve β-cell function and insulin secretion

    • This could represent a novel approach for maintaining glycemic control in type 2 diabetes

  • Renal cancer therapy:

    • Strategies to upregulate SLC27A2 expression might suppress tumor proliferation and invasion

    • This approach could potentially improve outcomes in ccRCC patients

Future research should focus on developing selective Slc27a2 inhibitors or activators and testing their efficacy in preclinical models before advancing to clinical studies.

What critical knowledge gaps remain in understanding Slc27a2 biology?

Despite significant advances, several important knowledge gaps remain:

  • Molecular regulation:

    • The precise transcriptional and post-translational regulation of Slc27a2 remains incompletely understood

    • Factors influencing tissue-specific expression patterns require further investigation

  • Substrate specificity:

    • While Slc27a2 is known to transport long-chain fatty acids, the complete profile of preferred substrates and their relative affinities is not fully characterized

    • The potential for Slc27a2 to transport other lipid species or drugs remains to be explored

  • Signaling pathways:

    • The downstream signaling pathways affected by Slc27a2 activity in different tissues and disease states require further elucidation

    • How Slc27a2 interacts with other metabolic regulators remains poorly understood

  • Human relevance:

    • Most studies have been conducted in mouse models, and the translation of findings to human physiology and pathology requires validation

    • Population studies examining SLC27A2 variants and their correlation with disease risk are needed

Addressing these knowledge gaps will require interdisciplinary approaches combining advanced genetic models, metabolomics, proteomics, and translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.