Recombinant Mouse Vesicle-associated membrane protein 2 (Vamp2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse VAMP2

VAMP2 is a 116-amino-acid (aa) type IV transmembrane protein belonging to the synaptobrevin family. Its recombinant form is typically produced in Escherichia coli with tags (e.g., His-tag, GST-tag) for purification and solubility. Key features include:

PropertyDetailsSource
Expression SystemE. coli
TagN-terminal His-tag (fragment: 1–94 aa) or GST-tag (full-length)
Purity>90% (SDS-PAGE validated)
Molecular Weight~13 kDa (His-tagged fragment) or ~40 kDa (GST-tagged full-length)
ApplicationsSDS-PAGE, mass spectrometry, Western blot, membrane fusion studies

Recombinant VAMP2 is widely used to study its role in SNARE complex assembly, vesicle fusion, and interactions with synaptic proteins like α-synuclein and syntaxin-1A .

Structure and Functional Domains

VAMP2 contains two key domains:

  1. Juxtamembrane Domain (JMD): Mediates electrostatic interactions with acidic phospholipids and α-synuclein, driving phase separation and membrane bending .

  2. Transmembrane Domain (TMD): Anchors the protein to vesicle membranes and stabilizes SNARE complex formation .

The JMD is critical for initiating membrane fusion, while the TMD ensures proper alignment of vesicle and target membranes .

Production and Characterization

Recombinant VAMP2 is produced via bacterial expression systems, with purification methods optimized for solubility and activity. Key characterization data includes:

ParameterHis-tagged Fragment (1–94 aa)GST-tagged Full-Length
SolubilityHigh in detergent-free buffersRequires GST tag for solubility
Membrane BindingConfirmed via Trp fluorescence assaysConfirmed via LC-MS/MS
Thermal StabilityStable at -20°C for long-term storageStable at -20°C

The His-tagged fragment is commonly used for structural studies, while the full-length GST-tagged form is preferred for functional assays .

Key Research Findings

Recent studies highlight VAMP2’s role in:

Membrane Fusion and SNARE Complex Assembly

  • Mechanism: VAMP2 forms a coiled-coil SNARE complex with syntaxin-1A and SNAP-25, generating force to fuse vesicles with target membranes .

  • Electrostatic Interactions: The JMD binds to phospholipid bilayers, inducing curvature and facilitating pore formation .

α-Synuclein Phase Separation

  • Interaction: VAMP2’s JMD drives α-synuclein (αSYN) phase separation via electrostatic interactions, particularly in lipid-bound αSYN .

  • Implications: Linked to Parkinson’s disease pathogenesis, as αSYN condensates accumulate in synucleinopathies .

Study FocusKey FindingsSource
αSYN Phase SeparationVAMP2 induces αSYN condensates in vitro and cells; dependent on JMD and lipid binding
Membrane FusionVAMP2 knockdown reduces neurotransmitter release and synaptic vesicle recycling
Electrostatic BindingJMD Trp residues penetrate lipid bilayers, confirmed via fluorescence assays

Applications in Research

Recombinant VAMP2 is pivotal in:

Neurotransmitter Release Studies

  • Model Systems: Used to investigate fast vesicular exocytosis and endocytosis in neurons .

  • Disease Models: VAMP2 mutations linked to epilepsy and Familial Infantile Myasthenia Gravis (FIMG) .

Insulin Signaling

  • GLUT4 Trafficking: VAMP2 facilitates insulin-stimulated translocation of GLUT4 in adipocytes .

Antibody Development

  • Detection: Monoclonal antibodies (e.g., MAB5136) enable Western blot detection of VAMP2 in human/mouse tissues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-116
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Uniprot No.

Target Background

Function
Vesicle-associated membrane protein 2 (Vamp2) plays a crucial role in targeting and fusing transport vesicles to their designated target membrane. As a primary SNARE protein found in synaptic vesicles, it mediates the fusion of these vesicles, leading to the release of neurotransmitters. Vamp2 is essential for rapid vesicular exocytosis and activity-dependent neurotransmitter release, as well as rapid endocytosis, which facilitates the efficient reuse of synaptic vesicles. Additionally, it regulates the gating properties of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene References Into Functions
  1. These findings suggest that the synaptobrevin-2 transmembrane domain contributes to the membrane fusion process through its structural flexibility, actively influencing the pace of fusion pore expansion. PMID: 27343350
  2. This study demonstrates that lipid-anchored syb2 offers limited support for exocytosis, while anchoring syb2 to a membrane via a TMD significantly enhances its functionality. PMID: 26663078
  3. Mutations in Vamp2 disrupt the ability of Munc18-1 to promote trans-SNARE zippering. These mutations inhibit both spontaneous and evoked neurotransmitter release, providing evidence for the regulatory role of Munc18-1 on Vamp2 in synaptic exocytosis. PMID: 26572858
  4. These results unveil a novel molecular mechanism for autocrine negative feedback regulation of insulin secretion. PMID: 26585489
  5. Findings suggest that side chains within the syb2 transmembrane domain influence the kinetics of exocytosis by altering the packing of surrounding lipids. PMID: 26153704
  6. This research presents transgenic mice expressing a ubiquitinated synaptic vesicle protein (Ub(G76V)-GFP-Syb2) that exhibit progressive degeneration of motor nerve terminals. PMID: 26290230
  7. VAMP2 is the primary v-SNARE involved in GLUT4 trafficking to the surface of 3T3-L1 adipocytes. PMID: 25501368
  8. These results indicate that the syb2 TMD plays a role in nascent fusion pores but in a structurally distinct arrangement compared to the syntaxin transmembrane domains. PMID: 25855187
  9. Clustering was observed to depend on specific interactions between native alpha-synuclein and both synaptobrevin-2/VAMP2 and anionic lipids. PMID: 23638301
  10. Findings point to an essential role for VAMP2 in GLP-1 exocytosis from the GLUTag L cell in response to various established secretagogues. PMID: 24356748
  11. Synaptobrevin2 is expressed in cytotoxic T lymphocytes and exclusively localized on granzyme B-containing lytic granules. PMID: 23385584
  12. Data suggest that tryptophans W89/W90 in the juxtamembrane region/transmembrane domain of Syb2 act as a fusion clamp in chromaffin cells. In mutant protein, alanines A89/A90 promote spontaneous membrane fusion. PMID: 23178715
  13. The tryptophan moiety in SybII maintains secretory vesicles in a release-ready state and supports a model where tryptophan-mediated protein-lipid interactions facilitate the bridging of opposing membranes prior to fusion. PMID: 23136435
  14. Microelectrode array measurements in specific hippocampal subregions of VAMP2(+/-) mice revealed significant reductions in potassium-evoked glutamate release. PMID: 22183055
  15. VAMP2 and VAMP3 are expressed in JG cells, but only VAMP2 is targeted to renin-containing granules and mediates the stimulatory effect of cAMP on renin exocytosis. PMID: 21708949
  16. Two copies of spH per synaptic vesicles (SV) fully rescued evoked fusion, whereas SVs expressing only one spH were unable to rapidly fuse upon stimulation. PMID: 21844343
  17. T3 may promote glucose uptake by enhancing insulin-induced phosphorylation of Akt and subsequent translocations of VAMP2 and glucose transporter GLUT4 in adipocytes. PMID: 21792921
  18. Multiple SybII actions contribute to the precise temporal regulation of neuronal signaling. PMID: 20685972
  19. Results suggest a model where the positively charged VAMP2 and syntaxin juxtamembrane regions facilitate fusion by bridging the negatively charged vesicle and plasma membrane leaflets. PMID: 19812247
  20. Vamp2 is essential for two fast synapse-specific membrane trafficking reactions: fast exocytosis for neurotransmitter release and fast endocytosis that mediates rapid reuse of synaptic vesicles. PMID: 15475946
  21. Vamp2 may contribute to catalyzing fusion reactions and stabilizing fusion intermediates but is not absolutely required for synaptic fusion. PMID: 11691998

Show More

Hide All

Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.
Tissue Specificity
Expressed in the outer plexiform layer of the retina (at protein level).

Q&A

What is the structural composition of Recombinant Mouse VAMP2?

Recombinant Mouse VAMP2 consists of four distinct structural domains that transform when interacting with other SNARE proteins. These domains include: a proline-rich N-terminal domain (residues 1-30), a SNARE motif or core domain (residues 31-85), a juxtamembrane domain (residues 86-95), and a C-terminal transmembrane domain (residues 96-114) . The typical recombinant form used in research is a fragment protein covering the 1-94 amino acid range, often expressed with a His-tag for purification purposes . This structural arrangement facilitates VAMP2's role in membrane fusion events, with the transformation from disordered to ordered states releasing free energy that drives SNARE complex formation .

What expression systems are most effective for producing functional Recombinant Mouse VAMP2?

Escherichia coli remains the predominant expression system for Recombinant Mouse VAMP2 production, consistently yielding protein with >90% purity suitable for various analytical techniques including SDS-PAGE and mass spectrometry . When expressing VAMP2, researchers should optimize culture conditions (temperature, induction timing, and IPTG concentration) to enhance protein solubility while minimizing aggregation. For studies requiring post-translational modifications, mammalian expression systems may be preferable, particularly when investigating phosphorylation events mediated by kinases such as PRKCZ . The choice of expression system should align with the specific experimental requirements, considering factors such as protein folding, modification patterns, and downstream applications.

What are the primary functional roles of VAMP2 in cellular processes?

VAMP2 serves as a major SNARE protein in synaptic vesicles, playing essential roles in multiple aspects of vesicular trafficking. It mediates the targeting and fusion of transport vesicles to their target membranes , functioning as a critical v-SNARE that drives membrane fusion events through interaction with t-SNAREs. VAMP2 is instrumental in facilitating fast vesicular exocytosis and activity-dependent neurotransmitter release . Additionally, it contributes to fast endocytosis processes that enable rapid reuse of synaptic vesicles . Recent research has uncovered its selective role in cargo-specific trafficking, particularly for μ opioid receptors (MORs), suggesting VAMP2 participates in receptor-specific recycling pathways distinct from other cargo proteins . Furthermore, VAMP2 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 .

How does VAMP2 participate in SNARE complex formation and what methodologies best capture this dynamic process?

VAMP2 combines with syntaxin-1A (SYX-1A) and synaptosome-associated protein 25 (SNAP-25) to form the core SNARE complex that drives fusion pore formation . This association triggers a conformational change in VAMP2 from a disordered to an ordered state, releasing free energy that powers membrane fusion . To effectively study these dynamics, researchers should employ multiple complementary approaches:

  • FRET-based assays: Fluorescence resonance energy transfer techniques allow real-time monitoring of SNARE complex assembly by labeling VAMP2 and partner proteins with donor-acceptor fluorophore pairs.

  • Single-molecule force spectroscopy: This approach can measure the energetics of SNARE complex formation and the forces generated during assembly.

  • Cryo-electron microscopy: Provides structural insights into intermediate states during complex formation.

  • High-speed multichannel imaging: Enables simultaneous visualization of VAMP2 with partner proteins in real-time during individual fusion events .

When designing experiments, researchers should consider that VAMP2's transformation through multiple conformational states is critical for its function, and experimental conditions should preserve these dynamic properties.

What evidence supports VAMP2's selective role in cargo trafficking, and how can this selectivity be investigated?

Recent research utilizing high-resolution imaging techniques has revealed that VAMP2 exhibits surprising cargo selectivity in vesicular trafficking. VAMP2 is preferentially enriched in vesicles that mediate the surface delivery of μ opioid receptors (MORs), but not other cargo proteins such as β2 adrenergic receptors (B2ARs) or transferrin receptors (TfRs) . This specificity challenges previous assumptions about SNARE protein function.

To investigate this selective cargo association, researchers have developed sophisticated methodological approaches:

  • High-resolution multichannel total internal reflection fluorescence microscopy (TIR-FM): This technique allows direct visualization of individual plasma membrane fusion events while simultaneously observing VAMP2 localization .

  • pH-sensitive fluorescent protein tagging: By tagging cargo proteins with super ecliptic pHluorin (SpH) and VAMP2 with pH-sensitive red fluorescent proteins like pHuji, researchers can precisely track when and where these proteins colocalize during fusion events .

  • Quantitative enrichment analysis: Statistical quantification of VAMP2 presence at fusion sites compared to surrounding membrane areas provides numerical evidence of selective enrichment .

The data indicates that VAMP2 shows specific enrichment at MOR fusion sites (with enrichment values significantly above background), while showing no preferential enrichment with other cargo types. This suggests a previously unrecognized level of organization in vesicular trafficking systems .

How do post-translational modifications affect VAMP2 function in research contexts?

VAMP2 undergoes phosphorylation by protein kinase C zeta (PRKCZ), a modification that is enhanced in the presence of WDFY2 . These post-translational modifications likely regulate VAMP2's interaction with other SNARE proteins and its participation in membrane fusion events.

When studying VAMP2 phosphorylation:

  • Site-directed mutagenesis: Creating phosphomimetic (e.g., serine to aspartate) or phosphodeficient (serine to alanine) mutants allows assessment of how specific phosphorylation sites affect VAMP2 function.

  • Kinase activity assays: In vitro phosphorylation assays using purified components can determine the efficiency and specificity of kinase activity toward VAMP2.

  • Phospho-specific antibodies: These enable detection of phosphorylated VAMP2 in various experimental contexts.

  • Mass spectrometry: Provides precise identification of phosphorylation sites and quantification of modification stoichiometry.

Researchers should be mindful that expression systems lacking appropriate kinases may produce VAMP2 with phosphorylation patterns different from those in native contexts, potentially affecting experimental outcomes.

What imaging techniques are most effective for studying VAMP2 trafficking and fusion events?

Advanced imaging techniques have revolutionized our understanding of VAMP2 dynamics. Based on recent research, the following methodologies have proven particularly effective:

  • High-speed multichannel total internal reflection fluorescence microscopy (TIR-FM): This approach allows simultaneous visualization of VAMP2 and cargo proteins during individual fusion events at the plasma membrane with exceptional temporal and spatial resolution .

  • pH-sensitive fluorescent protein tagging strategies: By tagging VAMP2 with pH-sensitive fluorophores like pHuji and cargo proteins with super ecliptic pHluorin (SpH), researchers can precisely track vesicle fusion events as the fluorescence dramatically increases when proteins transition from acidic vesicle interiors (pH 4.5-6.5) to the neutral extracellular environment (pH 7.4) .

  • Dual-color imaging optimization: When simultaneously imaging VAMP2 and cargo proteins, careful selection of fluorophores with minimal spectral overlap is essential, as is proper calibration to account for different photobleaching rates.

A typical experimental design employs:

  • Acquisition rates of 10-20 frames per second to capture rapid fusion events

  • Exposure times of 50-100 ms per channel

  • Temperature-controlled imaging chambers to maintain physiological conditions

  • Analysis software capable of detecting and quantifying transient fusion events

This approach has revealed that VAMP2 shows significantly higher enrichment at MOR fusion sites compared to other cargo proteins, with median enrichment values exceeding background levels .

What are the critical controls needed when designing VAMP2 knockdown or knockout experiments?

When manipulating VAMP2 expression to study its function, several critical controls must be implemented:

  • Alternative VAMP protein controls: Include related VAMP subtypes (e.g., VAMP4) to assess specificity, as studies have shown VAMP4 does not show the same preferential enrichment in MOR-containing vesicles as VAMP2 .

  • Rescue experiments: Express RNAi-resistant VAMP2 constructs to confirm phenotype specificity.

  • Temporal controls: Use inducible systems (e.g., doxycycline-inducible shRNA) to distinguish between developmental and acute effects of VAMP2 depletion .

  • Cell-type specificity: Validate VAMP2 knockdown effects across different cell types, as shown by studies in both PC12 cells and rat striatal neurons .

  • Pathway specificity analysis: Determine whether VAMP2 depletion affects all trafficking pathways or only specific ones by examining multiple cargo types.

When analyzing results, researchers should quantify both individual recycling events and total surface receptor levels to comprehensively assess VAMP2's role in trafficking .

What purification strategies yield the highest quality Recombinant Mouse VAMP2 for in vitro studies?

Obtaining high-purity, properly folded Recombinant Mouse VAMP2 is critical for reliable in vitro studies. The following purification approach has proven effective:

  • Expression optimization: Using E. coli expression systems with His-tagged constructs covering the 1-94 amino acid range of VAMP2 .

  • Sequential purification strategy:

    • Initial capture via immobilized metal affinity chromatography (IMAC)

    • Secondary purification through size exclusion chromatography

    • Optional ion exchange chromatography for removing contaminants

  • Quality control assessments:

    • SDS-PAGE to confirm >90% purity

    • Mass spectrometry to verify protein identity and integrity

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate protein homogeneity

  • Storage considerations: Aliquot in small volumes, flash-freeze in liquid nitrogen, and store at -80°C to maintain functional integrity.

This approach consistently yields Recombinant Mouse VAMP2 with >90% purity suitable for analytical techniques including SDS-PAGE and mass spectrometry applications .

How should researchers address apparent contradictions in VAMP2 localization studies?

VAMP2 localization studies sometimes yield apparently contradictory results, particularly regarding its distribution across different cellular compartments. To address these contradictions, researchers should:

  • Consider temporal dynamics: VAMP2 rapidly cycles between different compartments, so apparent contradictions may reflect different snapshots of a dynamic process.

  • Evaluate methodological differences:

    • Fixation protocols can dramatically affect VAMP2 localization results

    • Live-cell versus fixed-cell imaging provides different temporal resolution

    • Antibody specificity in immunolocalization studies must be validated

  • Examine subcellular context: Recent research shows VAMP2 is enriched in endosomes but not in Golgi compartments (unlike VAMP4), contradicting some earlier studies . This highlights the importance of:

    • Using multiple organelle markers (e.g., TGN38 for trans-Golgi, GM130 for cis-Golgi)

    • Quantitative colocalization analysis rather than qualitative assessment

    • Super-resolution microscopy to resolve closely positioned structures

  • Analyze cargo-dependent distribution: VAMP2 shows specific enrichment in vesicles containing certain cargo (like MOR) but not others (like B2AR or TfR) , suggesting its distribution varies depending on the trafficking pathway being studied.

CompartmentVAMP2 EnrichmentValidation MethodReference
EndosomesYesColocalization with endosomal markers
Golgi apparatusNoColocalization with TGN38 and GM130
MOR-containing vesiclesYesTIR-FM with pH-sensitive tags
B2AR-containing vesiclesNoTIR-FM with pH-sensitive tags
TfR-containing vesiclesNoTIR-FM with pH-sensitive tags

What statistical approaches are most appropriate for analyzing VAMP2 enrichment in vesicle fusion events?

When analyzing VAMP2 enrichment in vesicle fusion events, appropriate statistical approaches are crucial for robust interpretation. Based on recent research methodologies, the following approaches are recommended:

  • Enrichment ratio calculation: Calculate the ratio of VAMP2 signal intensity at fusion sites compared to surrounding membrane areas as a measure of specific enrichment .

  • Standard deviation normalization: Express enrichment values as multiples of standard deviation (SD) of background signal to facilitate comparison across experiments with different absolute fluorescence intensities .

  • Non-parametric statistical tests: Use Mann-Whitney U tests or Kruskal-Wallis tests for comparing enrichment values, as fusion event data often does not follow normal distribution .

  • Multiple timepoint analysis: Analyze VAMP2 enrichment at several timepoints relative to fusion (e.g., -2s, 0s, +2s) to capture dynamic changes.

  • Bootstrap confidence interval estimation: Generate confidence intervals for enrichment values to assess statistical significance more robustly than simple p-values.

When interpreting results, researchers should consider that:

  • An enrichment value of >1× SD above background indicates specific association

  • Values <1× SD suggest random distribution without specific enrichment

  • Comparative analysis between different cargo types provides the strongest evidence for selective association

This approach revealed significant VAMP2 enrichment in MOR fusion events (median enrichment >1× SD) but not in B2AR or TfR events, providing statistical evidence for cargo selectivity .

How can researchers determine if VAMP2's role is cargo-specific versus generally involved in all trafficking pathways?

Determining whether VAMP2 plays a cargo-specific role versus a general role in trafficking requires careful experimental design and data analysis:

  • Simultaneous multi-cargo tracking: Express multiple fluorescently tagged cargo proteins (e.g., MOR, B2AR, TfR) in the same cells and analyze whether VAMP2 associates preferentially with specific cargo fusion events .

  • Selective depletion studies: Use VAMP2 knockdown or knockout approaches and quantify the effects on different cargo proteins. Recent studies show VAMP2 depletion specifically reduced MOR recycling while having minimal impact on other cargos .

  • Quantitative colocalization analysis:

    • Calculate Manders' overlap coefficients for VAMP2 with different cargo proteins

    • Use object-based colocalization analysis to determine the percentage of vesicles positive for both VAMP2 and specific cargo

    • Implement proximity ligation assays to detect close associations in fixed samples

  • Rescue experiment design: Create cargo-selective rescue conditions by expressing modified versions of VAMP2 that preferentially interact with specific trafficking machinery.

When analyzing the data, researchers should look for:

  • Differential effects of VAMP2 manipulation on trafficking rates of various cargo proteins

  • Selective enrichment patterns at fusion sites of specific cargo types

  • Distinct kinetic parameters of vesicle fusion for different cargo proteins in VAMP2-depleted conditions

Recent research conclusively demonstrated that VAMP2 is selectively required for MOR recycling but not for B2AR or TfR trafficking, establishing a paradigm for cargo-specific roles of SNARE proteins .

How is VAMP2 research informing potential therapeutic applications beyond neuroscience?

Research on VAMP2 is expanding beyond traditional neuroscience applications into new therapeutic areas. Studies on Schistosoma japonicum VAMP2 (SjVAMP2) have revealed promising vaccine potential against schistosomiasis . Recombinant SjVAMP2 formulated with ISA206 adjuvant induced significant reductions in worm burden (41.5% and 27.3%) and hepatic eggs (36.8% and 23.3%) in two independent trials . The protective mechanism appears to involve robust humoral immunity, with significantly elevated rSjVAMP2-specific IgG, IgG1, and IgG2a levels detected in vaccinated mice .

Additionally, VAMP2's selective role in μ opioid receptor (MOR) trafficking suggests potential therapeutic relevance for pain management and addiction treatment . By understanding the selective regulation of receptor trafficking, researchers may develop approaches to specifically modulate opioid receptor signaling while minimizing effects on other pathways.

Future therapeutic applications may include:

  • Targeted disruption of parasite membrane integrity by interfering with SjVAMP2 function

  • Selective modulation of receptor recycling to enhance or diminish specific signaling pathways

  • Development of small-molecule modulators of VAMP2-cargo interactions for specific therapeutic outcomes

What techniques are emerging for studying the real-time dynamics of VAMP2 in complex cellular environments?

Cutting-edge techniques for studying VAMP2 dynamics in complex cellular environments are revolutionizing our understanding of its function:

  • Lattice light-sheet microscopy: Provides exceptional spatial and temporal resolution with reduced phototoxicity, enabling extended imaging of VAMP2 dynamics in living systems.

  • Expansion microscopy: Physically expands samples to achieve super-resolution imaging of VAMP2 localization using standard microscopes.

  • CRISPR-based tagging strategies: Enables endogenous labeling of VAMP2 to study its dynamics without overexpression artifacts.

  • Optogenetic approaches: Allows precise temporal control of VAMP2 function through light-activated domains fused to VAMP2 or its interaction partners.

  • pH-sensitive dual-color imaging: The combination of super ecliptic pHluorin (SpH) with pH-sensitive red fluorescent proteins like pHuji has enabled simultaneous visualization of VAMP2 with cargo proteins during individual fusion events .

  • Correlative light and electron microscopy (CLEM): Combines the temporal resolution of fluorescence microscopy with the ultrastructural detail of electron microscopy to study VAMP2 localization during trafficking events.

The most promising approaches integrate multiple techniques, such as combining high-speed multichannel imaging with precise genetic manipulations to establish causality between VAMP2 localization and functional outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.