Recombinant Mouse Vesicle-associated membrane protein 4 (Vamp4)

Shipped with Ice Packs
In Stock

Description

Secretory Pathway Regulation

  • TGN-to-endosome trafficking: Colocalizes with syntaxin 6 on clathrin-coated TGN membranes, mediating anterograde transport .

  • Insulin homeostasis: In pancreatic β cells, VAMP4 directs immature insulin secretory granules (iISGs) to lysosomes for (pro)insulin degradation, maintaining glucose-responsive insulin levels .

Synaptic Vesicle Dynamics

  • Release probability (Pr) modulation:

    • VAMP4 knockout (KO) increases synaptic Pr by 30–40%, impairing short-term facilitation .

    • Activity-dependent sorting to endolysosomes reduces VAMP4 accumulation at synapses, tuning neurotransmission .

Immune Cell Function

  • NK cell cytotoxicity: Required for lytic granule release, with RNAi knockdown reducing degranulation by >50% .

Key Research Findings

Model SystemPhenotype/EffectReference
VAMP4 KO miceHyperinsulinemia, impaired glucose tolerance, and insulin granule accumulation
Hippocampal neuronsIncreased synaptic release probability and depression during high-frequency stimuli
PC12 cellsLocalization to immature secretory granules and TGN clathrin-coated vesicles
NK cells70% reduction in target cell lysis upon VAMP4 knockdown

Interaction Partners and Complexes

  • Syntaxin 6: Forms a SNARE complex for TGN-to-endosome transport .

  • STX7/STX8/VTI1B: Mediates lysosomal fusion of insulin granules .

  • Clathrin: Associates with VAMP4-positive vesicles during maturation .

Experimental Tools and Applications

  • Antibody generation: Anti-VAMP4 antibodies target residues 2–115 for immunofluorescence and immunoprecipitation .

  • Fluorescent reporters: pHluorin-tagged VAMP4 reveals activity-dependent trafficking in live neurons .

  • KO models: Used to dissect metabolic and neurological phenotypes .

Implications for Disease and Therapeutics

  • Diabetes: Dysregulated VAMP4 exacerbates insulin secretion defects, suggesting therapeutic targeting potential .

  • Neurodegeneration: Altered VAMP4-endolysosomal coupling may contribute to synaptic dysfunction in aging .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. Should you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vamp4; Vesicle-associated membrane protein 4; VAMP-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vamp4
Target Protein Sequence
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT
Uniprot No.

Target Background

Function
Vamp4 is involved in the pathway responsible for removing an inhibitor (likely synaptotagmin-4) of calcium-triggered exocytosis during secretory granule maturation. It may serve as a marker for this sorting pathway, which is crucial for remodeling the secretory response of granules.
Gene References Into Functions
  1. Cholesterol modulates Vamp4 distribution in insulin granule membranes. PMID: 22889194
  2. The cytoplasmic domain of this protein is responsible for its proper subcellular targeting. The N-terminal extension contains a dominant autonomous targeting signal for the trans-golgi network. PMID: 12682051
Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein.

Q&A

What is VAMP4 and how does it function in neuronal systems?

VAMP4 is a vesicle-associated membrane protein belonging to the SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein Receptor) family. Unlike other synaptic vesicle-associated proteins, VAMP4 serves as both an essential cargo molecule for activity-dependent bulk endocytosis (ADBE) and a regulator of synaptic vesicle release probability (Pr) . VAMP4 functions through its SNARE motif, which has approximately 62% sequence similarity to synaptobrevin 2 (syb2), but with critical variations that affect SNARE complex formation kinetics . These sequence differences result in VAMP4 having reduced efficiency in forming SNARE complexes with canonical plasma membrane Q-SNAREs during synaptic activity, which contributes to its role in modulating neurotransmitter release . Additionally, VAMP4 undergoes selective endolysosomal sorting during ADBE, establishing a mechanism that connects synaptic activity to protein homeostasis in neurons .

How can researchers differentiate between VAMP4 and other vesicle-associated proteins experimentally?

Differentiating VAMP4 from other vesicle-associated proteins requires exploiting its unique trafficking and fluorescence profiles. When tagged with pH-sensitive reporters like pHluorin, VAMP4 displays a characteristic activity-dependent fluorescence profile that distinguishes it from other synaptic vesicle cargo proteins . While most pHluorin-tagged synaptic vesicle proteins show a fluorescence increase during stimulation followed by a decrease during endocytosis, VAMP4-pHluorin exhibits an immediate downstroke during high-frequency stimulation (40 Hz) followed by either a slow decrease or increase in fluorescence post-stimulation . This unique profile reflects VAMP4's selective retrieval during intense neuronal activity. Additionally, researchers can use acid quenching experiments to distinguish VAMP4 from other vesicle proteins, as approximately 40% of VAMP4-pHluorin signal remains resistant to acid quenching after high-frequency stimulation, indicating its localization in slowly acidifying bulk endosomes rather than rapidly acidifying synaptic vesicles .

What phenotypes are observed in VAMP4 knockout models?

VAMP4 knockout neuronal cultures and circuits display several distinct phenotypes that highlight its critical regulatory functions. Most notably, VAMP4 KO neurons exhibit significantly increased synaptic vesicle release probability (Pr) . When measuring evoked excitatory postsynaptic currents (EPSCs), VAMP4 KO hippocampal slices show increased amplitude of the first EPSC relative to the readily releasable pool (RRP) size, confirming elevated Pr . Functionally, this translates to an inability to sustain presynaptic facilitation, with VAMP4 KO neurons showing significant depression of glutamate sensor (iGluSnFR) responses during short action potential bursts compared to wild-type . Using sypHy (synaptophysin-pHluorin) measurements, VAMP4 KO neurons display markedly increased fluorescence amplitudes in response to 40-action potential trains without changes in total recycling pool (TRP) size, further confirming elevated fusion competence of vesicles in the RRP . Importantly, these phenotypes can be rescued by overexpression of wild-type VAMP4, demonstrating specificity of the knockout effect .

What tools are available for detecting and quantifying VAMP4 in experimental systems?

Detection MethodApplicationAdvantagesLimitations
VAMP4-pHluorinLive imaging of VAMP4 traffickingReveals real-time dynamics, distinguishes surface vs. internal poolsRequires transfection, potential overexpression artifacts
Biochemical fractionationQuantifying endogenous VAMP4 distributionDetects native protein, enables subcellular localization studiesLabor-intensive, requires substantial cellular material
ImmunofluorescenceLocalization of endogenous VAMP4Maps distribution across multiple subcellular compartmentsFixed samples only, antibody specificity concerns
shRNA knockdown validationConfirming specificity of VAMP4 effectsTests causality, quantifies knockdown efficiencyPotential off-target effects, incomplete knockdown

For reliable detection and quantification of VAMP4, researchers commonly employ VAMP4-pHluorin, a pH-sensitive GFP variant fused to VAMP4, which allows live imaging of VAMP4 trafficking during neuronal activity . Biochemical fractionation techniques using Nycodenz gradients can effectively separate bulk endosomes from other subcellular compartments, enabling analysis of endogenous VAMP4 enrichment in specific fractions . Validation of VAMP4 knockdown efficiency can be performed using established shRNA oligonucleotides, with approximately 70-80% reduction in protein levels achievable in hippocampal neurons . When combined with functional assays like TMR-dextran uptake, these tools provide complementary approaches for investigating VAMP4's localization and function in neuronal systems.

How does VAMP4 regulate activity-dependent bulk endocytosis (ADBE)?

VAMP4 serves as both a cargo and an essential component for activity-dependent bulk endocytosis (ADBE) through multiple mechanisms. Fluorescence imaging studies using VAMP4-pHluorin reveal that VAMP4 is selectively retrieved from the plasma membrane during intense stimulation that triggers ADBE (40 Hz action potentials) . This selective retrieval is independent of clathrin-mediated endocytosis (CME), as demonstrated by experiments using pitstop-2 to arrest CME, which did not affect the VAMP4-pHluorin fluorescence downstroke during high-frequency stimulation . Acid quenching experiments further confirm that approximately 40% of VAMP4-pHluorin resides in slowly acidifying compartments (bulk endosomes) after intense stimulation, compared to complete quenching at lower stimulation frequencies (10 Hz) that do not trigger ADBE .

Critically, VAMP4 is not merely cargo but is essential for ADBE to proceed. shRNA-mediated knockdown of VAMP4 abolishes TMR-dextran uptake (a marker of ADBE) during high-frequency stimulation without affecting synaptophysin-pHluorin responses (indicating preserved CME) . This ADBE defect can be fully rescued by expression of wild-type VAMP4-pHluorin, confirming specificity . The exact molecular mechanism by which VAMP4 enables ADBE remains under investigation, but likely involves its interaction with specific endocytic adaptors and/or its role in membrane deformation or scission events necessary for bulk endosome formation.

What is the molecular mechanism by which VAMP4 controls synaptic vesicle release probability?

VAMP4 regulates synaptic vesicle release probability (Pr) through multiple interconnected mechanisms:

  • Inefficient SNARE complex formation: VAMP4's SNARE motif has approximately 62% sequence similarity to synaptobrevin 2 (syb2), but contains critical variations that reduce its ability to form efficient SNARE complexes with canonical plasma membrane Q-SNAREs . This reduced fusogenicity directly impacts the release competence of vesicles containing VAMP4.

  • Activity-dependent clearance: During intense neuronal activity, VAMP4 undergoes selective sorting into bulk endosomes via ADBE, followed by trafficking to endolysosomes . This clearance mechanism reduces VAMP4 levels in recycling synaptic vesicles, maintaining low Pr under normal conditions.

  • Molecular rheostat function: VAMP4 acts as a "molecular rheostat" that adjusts Pr based on both input-specific activity patterns and cell-wide alterations in proteostasis . Inhibition of either ADBE or endolysosomal trafficking significantly increases VAMP4 abundance in nerve terminals, thereby inhibiting synaptic vesicle fusion .

  • Competitive interaction: The negative correlation observed between VAMP4-pHluorin expression levels and evoked synaptic responses suggests that VAMP4 may competitively interact with or regulate other components of the release machinery .

How do experimental manipulations of the endolysosomal system affect VAMP4 trafficking and function?

Manipulations of the endolysosomal system profoundly affect VAMP4 trafficking and function, revealing the tight coupling between endolysosomal health and synaptic strength regulation. The table below summarizes key experimental manipulations and their effects:

Experimental ManipulationEffect on VAMP4Functional ConsequenceCitation
T22N rab7 mutant expressionIncreased synaptic VAMP4 levelsDecreased RRP SV fusion capacity
ADBE inhibitionElevated nerve terminal VAMP4Inhibited SV fusion
AP1 function disruptionImpaired cargo sorting to endolysosomesSynaptic VAMP4 enrichment and reduced turnover
VAMP4 knockoutN/AEnhanced Pr, inability to sustain facilitation

Inhibition of endolysosomal trafficking using the dominant-negative T22N rab7 mutant leads to decreased readily releasable pool (RRP) synaptic vesicle fusion capacity . Similarly, direct inhibition of ADBE also inhibits synaptic vesicle fusion . Critically, both effects are occluded in VAMP4 knockout nerve terminals, confirming that these manipulations affect release probability primarily through their impact on VAMP4 trafficking . This demonstrates that both ADBE and endolysosomal trafficking are essential for maintaining low VAMP4 levels in recycling synaptic vesicles, which is necessary for preserving normal release probability. When endolysosomal function is compromised, VAMP4 accumulates in nerve terminals, effectively acting as a brake on excessive excitatory neurotransmission – a potential neuroprotective mechanism during pathological conditions .

What experimental approaches can reliably distinguish between VAMP4-mediated effects on endocytosis versus exocytosis?

Distinguishing between VAMP4's effects on endocytosis versus exocytosis requires a combination of complementary experimental approaches:

How does the composition of VAMP4-containing vesicles affect their functional properties in neurons?

VAMP4-containing vesicles exhibit distinct functional properties that directly impact synaptic physiology. Research has revealed several key aspects of how vesicle composition affects function:

These properties establish VAMP4-containing vesicles as specialized regulators of synaptic strength, integrating both input-specific activity patterns and cell-wide signals related to protein homeostasis to fine-tune neurotransmitter release.

What are the optimal expression systems for producing functional recombinant mouse VAMP4?

The choice of expression system for recombinant mouse VAMP4 significantly impacts protein functionality and experimental outcomes. Based on current research approaches, several expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
HEK293T cellsHigh transfection efficiency, mammalian processingNon-neuronal contextBiochemical assays, protein-protein interactions
Primary neuronal culturesNative neuronal environment, physiological traffickingVariable expression, complex preparationLive imaging, electrophysiology, trafficking studies
Bacterial systems (E. coli)High yield, cost-effectiveLacks post-translational modificationsStructural studies, antibody production
Lentiviral systemsStable expression, targets neurons efficientlySafety concerns, size limitationsLong-term in vivo studies, knockout rescue experiments

For fluorescent fusion constructs like VAMP4-pHluorin, calcium phosphate transfection of primary hippocampal or cerebellar neurons provides optimal expression for trafficking studies . Expression levels should be carefully titrated, as high overexpression may artificially saturate trafficking mechanisms or sorting machinery. For biochemical studies requiring larger protein quantities, mammalian expression systems with neuronal-like processing (such as Neuro2A or SH-SY5Y cells) often provide a good balance between yield and functional relevance. When studying function in neuronal circuits, validated lentiviral expression systems that allow rescue experiments in VAMP4 knockout neurons have been successfully employed to confirm specificity of observed phenotypes .

How can researchers effectively measure VAMP4 trafficking in neuronal systems?

Effective measurement of VAMP4 trafficking requires multiple complementary approaches:

  • Live imaging with pH-sensitive reporters: VAMP4-pHluorin provides the most direct method for tracking VAMP4 trafficking in real-time. The characteristic fluorescence profile during high-frequency stimulation (40 Hz) shows an immediate downstroke followed by either slow decrease or increase in fluorescence post-stimulation . This unique profile can be measured at individual boutons to detect heterogeneity in trafficking responses.

  • Acid quenching experiments: Applying impermeant acid solutions immediately after stimulation distinguishes surface-exposed VAMP4-pHluorin from internalized protein. After high-frequency stimulation, approximately 40% of VAMP4-pHluorin signal remains resistant to quenching, indicating localization in slowly acidifying bulk endosomes .

  • Biochemical fractionation: Using discontinuous Nycodenz gradients allows separation and enrichment of bulk endosomes from other cellular compartments. This approach enables quantification of endogenous VAMP4 enrichment in different subcellular fractions, confirming its selective sorting during ADBE .

  • Dual-color imaging: Co-expressing VAMP4 tagged with one fluorophore and other trafficking markers (Rab proteins, endosomal markers) tagged with spectrally distinct fluorophores enables simultaneous tracking of VAMP4 through multiple compartments.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can measure the mobility and exchange rates of VAMP4 between different pools, providing insights into its dynamic trafficking between compartments.

For quantitative analysis, researchers should measure multiple parameters including retrieval kinetics (time constant of fluorescence downstroke), sorting efficiency (percentage resistant to acid quenching), and subcellular distribution (colocalization with different compartment markers).

What controls are essential for validating VAMP4 knockout and knockdown experiments?

Rigorous validation of VAMP4 manipulation experiments requires a comprehensive set of controls:

  • Expression level verification: Western blot analysis should confirm >70% reduction in VAMP4 protein levels following shRNA knockdown . For knockout models, complete absence of the protein should be demonstrated across multiple tissue samples.

  • Specificity controls: Measurement of other synaptic proteins (synaptobrevin2, SNAP-25, syntaxin1) should confirm that knockdown or knockout specifically affects VAMP4 without altering levels of other SNARE proteins .

  • Functional rescue experiments: Expression of wild-type VAMP4 in knockout or knockdown systems should rescue the observed phenotypes. For example, wild-type VAMP4-pHluorin expression restores TMR-dextran uptake in VAMP4 knockdown neurons and normalizes elevated release probability in VAMP4 knockout neurons .

  • Mode-specific controls: VAMP4 knockdown should not affect clathrin-mediated endocytosis, as measured by synaptophysin-pHluorin responses during high-frequency stimulation, while specifically abolishing ADBE measured by TMR-dextran uptake .

  • Negative controls: Non-targeting shRNA or appropriate genetic background controls for knockout models should be included in all experiments to account for non-specific effects of the manipulation procedures.

  • Structural/ultrastructural analysis: Electron microscopy should confirm normal synaptic morphology despite VAMP4 manipulation, ensuring that phenotypes reflect specific protein functions rather than general synaptic disruption.

These controls collectively ensure that observed phenotypes result specifically from VAMP4 manipulation rather than off-target effects or general cellular dysfunction.

How might VAMP4 function be implicated in neurological disorders?

VAMP4's role as a molecular rheostat linking endolysosomal function to synaptic release probability positions it as a potential contributor to various neurological disorders. Several lines of evidence suggest promising research directions:

  • Neurodegenerative diseases: Endolysosomal dysfunction is central to both synaptic senescence and neurodegeneration . VAMP4 may act as a protective brake on excessive excitatory neurotransmission during neuronal pathology, potentially providing a regulatory feedback loop through which dysfunctional endolysosomal degradation systems signal to the synaptic vesicle fusion machinery . This suggests VAMP4 as a potential therapeutic target in conditions like Alzheimer's and Parkinson's diseases.

  • Epilepsy and excitotoxicity: VAMP4 knockout neurons display increased release probability and inability to sustain facilitation , characteristics that could contribute to hyperexcitability. Investigating VAMP4 levels and function in models of epilepsy and excitotoxicity could reveal whether dysregulation of VAMP4-mediated feedback contributes to these conditions.

  • Synaptic plasticity disorders: As a regulator of short-term plasticity, VAMP4 dysfunction could impact learning and memory processes. The reduced ability of VAMP4 knockout circuits to sustain facilitation suggests potential involvement in disorders characterized by altered synaptic plasticity, such as certain forms of intellectual disability.

  • Proteostasis-related disorders: The coupling between VAMP4 trafficking and endolysosomal function creates a mechanism by which global alterations in neuronal proteostasis can influence synapse-specific release properties . This may be particularly relevant in disorders where proteostasis is compromised, including various proteinopathies.

Future research should investigate VAMP4 expression, localization, and function in patient samples and disease models, with particular attention to how its regulatory properties might be harnessed for therapeutic benefit.

What technological advances would facilitate deeper understanding of VAMP4 function?

Several technological advances would significantly enhance our understanding of VAMP4 function:

  • Super-resolution imaging techniques: Techniques like STORM, PALM, and STED microscopy would enable visualization of VAMP4 distribution and trafficking at nanoscale resolution, potentially revealing organizational principles not visible with conventional microscopy.

  • Optogenetic control of VAMP4 function: Development of light-sensitive VAMP4 variants would allow temporal and spatial control of its activity, enabling precise manipulation of its function during specific phases of synaptic transmission.

  • Single-vesicle analysis methods: Technologies that can track and analyze individual synaptic vesicles would reveal how VAMP4 content varies among vesicles and how this variation correlates with fusion properties.

  • In vivo imaging approaches: Advances in in vivo imaging would enable visualization of VAMP4 trafficking in intact neural circuits, potentially revealing activity-dependent regulation in behaviorally relevant contexts.

  • Cryo-electron microscopy: High-resolution structures of VAMP4-containing SNARE complexes would provide molecular insights into how its sequence variations affect complex stability and fusion kinetics.

  • Proteomics approaches: Advanced proteomics techniques could identify the complete interactome of VAMP4 across different subcellular compartments and activity states, revealing novel regulatory partners.

  • CRISPR-based screening: Genome-wide CRISPR screens for modifiers of VAMP4 function could uncover unexpected regulatory pathways and mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.