Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sec22a; Sec22l2; Vesicle-trafficking protein SEC22a; SEC22 vesicle-trafficking protein homolog A; SEC22 vesicle-trafficking protein-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sec22a
Target Protein Sequence
MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNI NFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV
Uniprot No.

Target Background

Function

May be involved in vesicle transport between the endoplasmic reticulum (ER) and the Golgi apparatus.

Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC22a and what is its role in cellular function?

SEC22a (also known as SEC22L2) is a member of the SEC22 family of vesicle trafficking proteins that primarily functions in the early stages of the secretory pathway. It operates as a v-SNARE (vesicle-SNARE) protein predominantly localized to the endoplasmic reticulum (ER) membrane and participates in membrane fusion events between transport vesicles and target membranes. SEC22a plays a critical role in regulating ER-Golgi trafficking in both anterograde and retrograde directions, which is essential for maintaining proper ER morphology and function . Unlike its yeast ortholog, mouse SEC22a does not appear to be directly involved in autophagosome formation, highlighting important evolutionary distinctions in its functional profile .

How does SEC22a differ from other SEC22 family proteins?

SEC22a is one of several SEC22 variants (including SEC22A, SEC22B, and SEC22C in humans). While all SEC22 family members share structural similarities and belong to the SNARE protein family, they exhibit tissue-specific expression patterns and potentially distinct functional roles. The most notable difference is that SEC22a primarily regulates ER-Golgi trafficking through its interactions with specific t-SNAREs like Syntaxin 5 (Syx5) . SEC22a appears to have specialized functions in maintaining ER morphology that may not be fully redundant with other family members. Research indicates that SEC22a forms specific protein complexes with binding partners such as Syx5 that distinguish its functionality from other SEC22 proteins .

What cellular phenotypes result from SEC22a deficiency?

SEC22a deficiency leads to several observable cellular phenotypes, most notably:

  • ER proliferation and expansion

  • Enlargement of late endosomes

  • Abnormal Golgi morphology

  • Disruption of normal membrane trafficking between ER and Golgi

In model organisms like Drosophila, loss of SEC22 results in photoreceptor morphogenesis defects, including small and sometimes fused rhabdomeres . With aging, the ER in SEC22 mutant cells becomes increasingly expanded and gradually loses normal morphology . Interestingly, starvation-induced autophagy is not affected by SEC22a loss, suggesting its primary role is in ER-Golgi trafficking rather than autophagosomal processes .

What are the optimal expression systems for producing recombinant mouse SEC22a protein?

For recombinant mouse SEC22a production, several expression systems have been successfully employed, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yield, cost-effective, rapid productionMay lack proper post-translational modifications10-50 mg/L
Mammalian cells (HEK293, CHO)Native-like folding and modificationsLower yield, higher cost1-5 mg/L
Baculovirus-insect cellsGood compromise between yield and modificationsMedium complexity5-20 mg/L
Yeast (P. pastoris)High yield with eukaryotic processingMay have different glycosylation patterns5-25 mg/L

When designing expression constructs, researchers should consider including appropriate affinity tags (His, GST, or FLAG) for purification while ensuring these additions don't interfere with protein functionality. For membrane-associated proteins like SEC22a, optimizing detergent conditions during purification is critical for maintaining proper folding and activity .

How can researchers effectively validate SEC22a antibody specificity for immunological studies?

Validating antibody specificity is crucial for reliable SEC22a detection. A comprehensive validation protocol should include:

  • Western blot analysis using both positive controls (tissues known to express SEC22a) and negative controls (SEC22a knockout or knockdown samples)

  • Immunoprecipitation followed by mass spectrometry to confirm target identity

  • Immunofluorescence with peptide competition assays to verify specificity

  • Cross-validation using multiple antibodies targeting different epitopes

  • Comparison of staining patterns with tagged recombinant SEC22a expression

Researchers should be particularly cautious about cross-reactivity with other SEC22 family members due to sequence homology. When using commercial antibodies, experimental validation is essential even when manufacturers claim specificity .

What purification strategies yield the highest purity and activity for recombinant mouse SEC22a?

Optimal purification of recombinant mouse SEC22a typically involves a multi-step approach:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Intermediate purification using ion-exchange chromatography

  • Polishing step with size-exclusion chromatography to remove aggregates

  • Buffer optimization to maintain protein stability

Critical considerations include:

  • Gentle detergent selection (n-dodecyl β-D-maltoside or CHAPS) for membrane protein solubilization

  • Addition of glycerol (5-10%) to stabilize protein structure

  • Use of reducing agents to maintain native conformation

  • Temperature control throughout purification (typically 4°C)

The purification protocol should be validated through SDS-PAGE, Western blotting, and functional assays to confirm both purity and biological activity .

How can CRISPR/Cas9 technology be optimized for SEC22a functional studies?

CRISPR/Cas9 approaches offer powerful tools for SEC22a functional studies. Researchers can implement:

  • Complete knockout strategies using multiple guide RNAs targeting critical exons

  • Knock-in approaches to introduce fluorescent tags or specific mutations

  • Activation systems (like the Synergistic Activation Mediator described in search result 3) for upregulation studies

  • Inducible CRISPR systems for temporal control of gene expression/deletion

For optimal results:

  • Design multiple guide RNAs with minimal off-target effects

  • Validate editing efficiency using sequencing and protein expression analysis

  • Consider tissue-specific or inducible Cas9 expression for developmental studies

  • Use appropriate controls including non-targeting guides and rescue experiments

When studying SEC22a's role in vesicular trafficking, researchers should consider potential compensatory mechanisms by other SNARE proteins following gene manipulation .

What are the most effective approaches for visualizing SEC22a-mediated trafficking events in live cells?

Live-cell visualization of SEC22a trafficking requires sophisticated imaging approaches:

  • Fluorescent protein tagging:

    • mGFP/mCherry fusion with SEC22a (preferably with flexible linkers)

    • Careful validation that tagging doesn't disrupt protein localization or function

    • Dual-color imaging with markers for different organelles (ER, ERGIC, Golgi)

  • Advanced microscopy techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • TIRF microscopy for visualizing events near the plasma membrane

    • Spinning disk confocal for rapid acquisition with minimal phototoxicity

    • Super-resolution techniques (STED, PALM, STORM) for nanoscale resolution

  • Analysis methods:

    • Particle tracking algorithms for vesicle movement quantification

    • Colocalization analysis with organelle markers

    • Measurement of trafficking rates under different conditions

These techniques can effectively visualize the dynamic interactions between SEC22a-containing vesicles and target membranes, providing insights into trafficking mechanisms .

How do SEC22a binding partners differ between species, and what are the implications for translational research?

The interactome of SEC22a exhibits both conservation and divergence across species:

SpeciesKey Binding PartnersUnique InteractionsFunctional Implications
MouseSyntaxin 5, SNAP proteinsSpecies-specific adaptor proteinsModel for mammalian systems
HumanSimilar to mouse, with additional regulatory partnersTissue-specific interaction networksTranslational research target
DrosophilaSyx5, Eyc (p47 homolog)Developmental regulatorsGenetic model for basic mechanisms
YeastSed5p (Syntaxin 5 homolog)Involvement in autophagyEvolutionary comparisons

These differences have important implications:

  • Mouse models can generally inform human SEC22a function, but species-specific interaction partners may exist

  • Yeast SEC22 involvement in autophagy differs from higher eukaryotes, limiting direct translation

  • Functional conservation should be experimentally validated when translating between model systems

Co-immunoprecipitation studies have confirmed that SEC22a forms complexes with Syntaxin 5 and other SNARE proteins in multiple species, suggesting conservation of core trafficking functions .

What is the role of SEC22a dysfunction in ER stress-related pathologies?

SEC22a dysfunction has significant implications for ER stress-related conditions:

  • Altered ER morphology: Loss of SEC22a leads to ER expansion and proliferation, which can trigger the unfolded protein response (UPR)

  • Disrupted protein trafficking: Impaired ER-Golgi transport causes protein accumulation in the ER

  • Cellular stress responses: Prolonged ER stress due to SEC22a dysfunction may activate pro-apoptotic pathways

The relationship between SEC22a and ER stress has been observed in multiple experimental systems, where SEC22a deficiency results in abnormal ER expansion similar to that seen in disease conditions . While the direct causal relationship remains under investigation, these findings suggest SEC22a dysfunction could contribute to conditions like neurodegeneration, diabetes, and certain inflammatory disorders where ER stress plays a pathogenic role.

How does SEC22a interact with other SNARE proteins to regulate membrane trafficking?

SEC22a engages in specific protein-protein interactions to facilitate membrane fusion:

  • SNARE complex formation: SEC22a (v-SNARE) interacts with Syntaxin 5 (t-SNARE) on the Golgi membrane to form a stable SNARE complex that drives membrane fusion

  • Regulatory interactions: The activity of this complex is modulated by additional factors such as SM (Sec1/Munc18) proteins

  • Recycling mechanisms: After fusion, SEC22a complexes are disassembled by NSF (N-ethylmaleimide-sensitive factor) and α-SNAP to allow reuse of the SNARE proteins

Immunoprecipitation studies have confirmed that SEC22a forms complexes with Syntaxin 5 in multiple model systems . Functional studies demonstrate that disruption of either SEC22a or Syntaxin 5 results in similar ER morphology defects, supporting their coordinated action in membrane trafficking .

What are the implications of SEC22a in developmental processes based on model organism studies?

Research in model organisms reveals critical developmental roles for SEC22a:

  • Drosophila studies:

    • SEC22 is essential for photoreceptor morphogenesis

    • Mutant flies display small and sometimes fused rhabdomeres

    • ER expansion in mutant photoreceptors progressively worsens with age

  • Cross-species comparisons:

    • In plants, SEC22 homologs are required for gametophyte development

    • Rice fungi studies show SEC22 is essential for cell wall integrity and morphogenesis

  • Developmental mechanisms:

    • SEC22a likely contributes to tissue morphogenesis through regulation of membrane trafficking

    • Proper ER-Golgi communication appears essential for cellular differentiation

    • The protein may have tissue-specific functions in specialized cell types

These findings suggest that SEC22a-mediated trafficking is particularly important in highly polarized or secretory cells, and its dysfunction may contribute to developmental abnormalities through disruption of protein trafficking and organelle homeostasis .

How can researchers overcome common challenges in generating functional recombinant SEC22a for in vitro studies?

Researchers face several challenges when producing functional recombinant SEC22a:

  • Protein solubility issues:

    • Solution: Use fusion tags like MBP or SUMO to enhance solubility

    • Alternative: Express only the soluble domain for certain applications

    • Consider detergent screening for optimal solubilization conditions

  • Maintaining native conformation:

    • Solution: Include appropriate cofactors in purification buffers

    • Monitor protein quality using circular dichroism or thermal shift assays

    • Validate functionality through binding partner interaction studies

  • Low expression yields:

    • Solution: Optimize codon usage for expression system

    • Test different promoter strengths and induction conditions

    • Consider baculovirus expression systems for improved yields of membrane proteins

  • Post-translational modifications:

    • Solution: Select expression systems that provide relevant modifications

    • Validate modification status using mass spectrometry

    • Assess functional impact of modifications through activity assays

These strategies can significantly improve the quality and quantity of recombinant SEC22a for research applications .

What are the most reliable methods for assessing SEC22a-mediated vesicle fusion in vitro?

Several robust methodologies can assess SEC22a-mediated vesicle fusion:

  • Fluorescence-based assays:

    • Lipid mixing assays using fluorescence resonance energy transfer (FRET)

    • Content mixing assays with self-quenching fluorescent dyes

    • Stopped-flow kinetic measurements for real-time fusion dynamics

  • Reconstitution systems:

    • Proteoliposomes containing purified SEC22a and partner SNAREs

    • Isolated membrane fractions from relevant cellular compartments

    • Microfluidic systems for controlled fusion events

  • Analytical approaches:

    • Electron microscopy to visualize membrane fusion intermediates

    • Light scattering to monitor vesicle size changes during fusion

    • Mass spectrometry to track membrane lipid and protein mixing

  • Controls and validation:

    • Use of dominant-negative SEC22a mutants as negative controls

    • Antibody-mediated inhibition to confirm specificity

    • Comparison with known fusion-defective SNARE mutants

These methods allow quantitative assessment of SEC22a's fusion activity and can reveal mechanistic details of how it contributes to membrane trafficking .

How should researchers interpret discrepancies between in vitro and in vivo findings on SEC22a function?

When faced with discrepancies between in vitro and in vivo SEC22a studies, researchers should consider:

  • Contextual differences:

    • In vivo systems contain the full complement of regulatory factors

    • Membrane composition varies between artificial and cellular membranes

    • Temporal and spatial regulation may be absent in vitro

  • Methodological considerations:

    • Validate key findings using multiple independent approaches

    • Consider protein tagging or purification artifacts

    • Assess whether expression levels match physiological conditions

  • Reconciliation strategies:

    • Use intermediate complexity systems (cell extracts, semi-intact cells)

    • Perform structure-function analyses to identify critical domains

    • Introduce complexity gradually to identify discrepancy sources

  • Species-specific differences:

    • Carefully consider evolutionary divergence in SEC22 function

    • Note that yeast Sec22p is involved in autophagy while animal SEC22a appears not to be

    • Document species-specific binding partners that might influence function

Understanding these factors can help explain seemingly contradictory results and develop a more comprehensive model of SEC22a biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.