Recombinant Mouse Vesicle-trafficking protein SEC22c (Sec22c)

Shipped with Ice Packs
In Stock

Description

Overview of SEC22C Protein

SEC22C belongs to the SEC22 family of vesicle-associated soluble N-ethylmaleimide-sensitive factor attachment protein receptors (v-SNAREs). It facilitates membrane fusion during cargo transport between the ER and Golgi apparatus . The recombinant mouse variant retains this functionality and is expressed in heterologous systems for biochemical and cellular studies .

Research Applications

  • Western Blot (WB): Used to detect endogenous SEC22C levels in mouse tissues .

  • ELISA: Quantifies protein interactions or antibody specificity .

  • Functional Studies: Investigates ER-Golgi trafficking dynamics and SNARE complex assembly .

  • Blocking Experiments: Recombinant proteins serve as controls for antibody validation .

Role in Vesicle Trafficking

  • ER-Golgi Transport: Facilitates anterograde and retrograde cargo movement by forming homodimers and promoting membrane fusion .

  • ER-Plasma Membrane Contact Sites: Enhances non-vesicular lipid transfer and calcium signaling .

Disease Relevance

  • Neurodegeneration: Murine Sec22c dysfunction mimics human pathologies like Alzheimer’s disease, linked to ER stress and autophagy defects .

  • Developmental Defects: Knockout models show impaired photoreceptor morphogenesis and ER/Golgi structural abnormalities .

Available Recombinant Mouse SEC22C Reagents

Catalog #HostTagPurityApplicationsSource
ABIN3125451MouseStrep Tag>70–80%WB, ELISA, SDS-PAGE Antibodies-Online
ABIN7551692HEK-293 CellsHis Tag>90%WB, Functional Studies Antibodies-Online
CSB-YP883585HU1YeastNoneInquireStructural Biology Cusabio

Expression and Purification Workflow

  1. Gene Synthesis: Codon-optimized SEC22C cDNA is cloned into expression vectors .

  2. Transfection: Expressed in HEK-293 cells or cell-free systems for high yield .

  3. Affinity Chromatography: Purified via Strep-Tactin® (Strep Tag) or Ni-NTA (His Tag) .

  4. Quality Control: Validated by mass spectrometry and biological activity assays .

Challenges and Limitations

  • Functional Assays: While in vitro binding assays are established, live-cell trafficking studies require additional validation .

  • Isoform Variability: Alternative splicing generates multiple isoforms, complicating antibody cross-reactivity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are happy to accommodate specific tag requests. Please inform us of your preference, and we will prioritize developing the specified tag.
Synonyms
Sec22c; Sec22l3; Vesicle-trafficking protein SEC22c; SEC22 vesicle trafficking protein-like 3; SEC22 vesicle-trafficking protein homolog C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sec22c
Target Protein Sequence
MSMILFASIVRVRDGLPLSASTDFYYAQEFLECRRQLKTLAQRLARHPGRGCAESCDFLI YFSSSGDVACMAICSRQCPAAMAFCFLEALWWDFIASYDTTCVGLASRPYAFLEFDSVIQ KTKWHFNHMSSSQMKSGLEKIQEELEFQPPAVLSLEDTDVANGMLNGHTPVHSEPAPNLR MKPVTALGVLSLVLNIMCAALNLIRGVHLAEHSLQVAQEEVGNILAFFIPSVACIVQCYL YLFYSPARTLKVLLMLASICLGNAYLHGLRNTWQILFHVGVAFLSSYQILTRQLQERQSD YGV
Uniprot No.

Target Background

Function
SEC22c, a vesicle-trafficking protein, plays a role in the transport of vesicles between the endoplasmic reticulum (ER) and the Golgi complex.
Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC22c and what is its primary function in cellular processes?

SEC22c is a member of the SEC22 family of vesicle trafficking proteins that plays an essential role in the early secretory pathway. It is primarily localized to the endoplasmic reticulum (ER) and functions in the early stages of ER-Golgi protein trafficking . As a SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein REceptor) protein, SEC22c participates in membrane fusion events necessary for vesicular transport between cellular compartments . The protein contains a cytoplasmic SNARE motif and a C-terminal transmembrane domain that anchors it to membranes . Recent evidence suggests that SEC22 proteins can form homodimers that may serve as dynamic intermediates necessary for efficient intracellular transport and promote the assembly of higher-order SNARE complexes required for membrane fusion events .

How does mouse SEC22c compare structurally and functionally to its homologs in other species?

Mouse Sec22c (gene ID: 215474) shares significant homology with SEC22c proteins in other mammalian species, including humans (gene ID: 9117), cows (gene ID: 614905), and other vertebrates . The evolutionary conservation of this protein across diverse species underscores its fundamental importance in vesicular trafficking mechanisms. The SNARE motif and transmembrane domains are particularly well-conserved regions, reflecting their critical roles in protein-protein interactions and membrane anchoring. Functional studies suggest that the mechanisms of SEC22c-mediated vesicle trafficking are largely conserved across species, though species-specific regulatory mechanisms may exist that modulate its activity in different cellular contexts or developmental stages.

What are the known alternatively spliced variants of mouse SEC22c and their functional implications?

Multiple isoforms of SEC22c have been identified resulting from alternative splicing . These splice variants may exhibit different subcellular localizations, interaction partners, or functional properties. The major isoforms differ primarily in their N-terminal regions, which may influence their regulatory mechanisms and participation in different SNARE complexes. When designing experiments targeting SEC22c, researchers should consider which specific isoform(s) they wish to study and design their recombinant constructs and detection methods accordingly.

What are the optimal expression systems for producing functional recombinant mouse SEC22c?

The choice of expression system for recombinant mouse SEC22c production should be guided by the experimental requirements and downstream applications. For structural and biochemical studies, bacterial expression systems (E. coli) can provide high yields but may lack appropriate post-translational modifications. For functional studies, mammalian expression systems (HEK293, CHO cells) are recommended as they provide the necessary cellular machinery for proper folding and post-translational modifications of membrane proteins .

When designing an expression construct, consider the following:

  • Include appropriate purification tags (His, FLAG, etc.) that will not interfere with protein function

  • Consider removing the transmembrane domain for improved solubility if membrane insertion is not required

  • Include proper signal sequences if secretion or specific subcellular targeting is desired

  • Use inducible promoters to control expression levels and timing

A systematic experimental design approach should be employed as outlined below:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yield, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
YeastPost-translational modifications, moderate yieldDifferent glycosylation patternsProtein-protein interaction studies
Insect cellsHigher eukaryotic PTMs, good yieldMore complex, costlier than bacteria/yeastFunctional assays, structural studies
Mammalian cellsNative-like PTMs and foldingLower yields, highest costTrafficking studies, functional assays

How can I design experiments to investigate SEC22c homodimer formation and its functional significance?

Based on recent findings about SEC22 proteins forming homodimers that play important roles in membrane fusion events , researchers may want to specifically investigate this phenomenon. A cysteine scanning approach has proven effective for detecting SEC22 homodimer formation in cellular membranes . This method involves:

  • Generating a series of cysteine substitution mutants throughout the SEC22c sequence, particularly within the SNARE motif and transmembrane domain

  • Expressing these mutants in appropriate cell systems

  • Analyzing disulfide cross-linking under oxidizing conditions

  • Detecting homodimer formation through non-reducing SDS-PAGE and western blotting

For functional studies, comparing wild-type SEC22c with mutants defective in homodimer formation can reveal the importance of this interaction. Experiments might include:

  • In vitro membrane fusion assays to measure fusion efficiency

  • Live-cell imaging to track vesicle trafficking dynamics

  • Co-immunoprecipitation studies to identify interaction partners

  • Electron microscopy to visualize membrane structures

The experimental design should follow rigorous scientific methodology, including appropriate controls, randomization where applicable, and statistical analysis of results .

What controls should be included when studying SEC22c interactions with other SNARE proteins?

When investigating interactions between SEC22c and other SNARE proteins, appropriate controls are essential to ensure the specificity and relevance of observed interactions . Consider including:

  • Negative controls:

    • Empty vector expressions

    • Non-relevant SNARE proteins unlikely to interact with SEC22c

    • SEC22c mutants with disrupted SNARE motifs

  • Positive controls:

    • Known interacting SNARE partners (e.g., Bet1, as SEC22-Bet1 heterodimers have been documented)

    • Previously validated protein-protein interactions

  • Technical controls:

    • Input protein levels (for co-immunoprecipitation experiments)

    • Subcellular fractionation quality controls

    • Antibody specificity validations

All experiments should include biological replicates (n≥3) and appropriate statistical analysis to ensure reproducibility, a critical aspect of scientific research .

How can I employ CRISPR-Cas9 gene editing to study SEC22c function in mouse models?

CRISPR-Cas9 technology offers powerful approaches for investigating SEC22c function through targeted gene editing. When designing a CRISPR-based study of SEC22c, consider:

  • Guide RNA design:

    • Target exons common to all splice variants for complete knockout

    • Target specific exons for isoform-selective studies

    • Use multiple guide RNAs to increase editing efficiency

    • Verify guide RNA specificity using genome databases

  • Editing strategies:

    • Complete knockout through frameshift mutations

    • Precise point mutations to study specific functional domains

    • Knock-in of reporter tags (GFP, mCherry) for localization studies

    • Conditional knockout using loxP/Cre systems

  • Validation approaches:

    • Genomic sequencing to confirm edits

    • Western blotting to verify protein expression changes

    • Functional assays to assess phenotypic consequences

The experimental design should follow the rigorous methodology principles outlined in research methods resources, ensuring proper controls and statistical analysis .

What advanced imaging techniques are most suitable for studying SEC22c trafficking dynamics?

Understanding the dynamic behavior of SEC22c in vesicle trafficking requires sophisticated imaging approaches. Consider these advanced techniques:

  • Super-resolution microscopy:

    • Stimulated Emission Depletion (STED) microscopy

    • Stochastic Optical Reconstruction Microscopy (STORM)

    • Photoactivated Localization Microscopy (PALM)
      These techniques overcome the diffraction limit of conventional microscopy and can resolve structures at the nanoscale, enabling visualization of individual vesicles and trafficking events.

  • Live-cell imaging:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Fluorescence Resonance Energy Transfer (FRET) to detect protein-protein interactions

    • Fluorescence Correlation Spectroscopy (FCS) to analyze diffusion properties

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines the specificity of fluorescence microscopy with the ultrastructural resolution of electron microscopy

    • Particularly valuable for visualizing SEC22c in the context of membrane structures

For all imaging experiments, appropriate controls and quantitative analysis methods should be employed to ensure reproducibility and meaningful data interpretation .

How can quantitative proteomics approaches be used to identify novel SEC22c interaction partners?

Mass spectrometry-based proteomics offers powerful tools for discovering novel SEC22c interacting proteins. A comprehensive approach might include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged SEC22c (FLAG, HA, or streptavidin) in appropriate cell systems

    • Perform immunoprecipitation under mild conditions to preserve interactions

    • Analyze co-precipitated proteins by LC-MS/MS

    • Apply robust statistical methods to identify specific interactors versus background

  • Proximity labeling approaches:

    • BioID: Fusion of SEC22c with a biotin ligase that biotinylates proximal proteins

    • APEX2: Fusion with an engineered peroxidase that generates reactive biotin-phenoxyl radicals

    • These methods can capture transient or weak interactions that might be lost in conventional AP-MS

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize protein-protein interactions

    • Digest and analyze crosslinked peptides by MS

    • Map interaction interfaces at amino acid resolution

  • Data analysis and validation:

    • Filter against appropriate control datasets

    • Validate key interactions by orthogonal methods (co-IP, FRET, etc.)

    • Perform functional studies on novel interactors

This experimental design follows established principles in proteomics research and should be executed with appropriate technical and biological replicates .

What strategies can overcome the challenges in purifying recombinant SEC22c with preserved functionality?

Purifying membrane proteins like SEC22c while maintaining their native conformation and functionality presents significant challenges. Consider these methodological approaches:

  • Detergent selection:

    • Screen multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

    • Consider using detergent mixtures for improved stability

    • Implement detergent exchange during purification to improve protein stability

  • Alternative solubilization strategies:

    • Nanodiscs: Membrane protein reconstitution into lipid bilayers supported by scaffold proteins

    • Amphipols: Amphipathic polymers that can replace detergents

    • Styrene-maleic acid copolymer lipid particles (SMALPs): Direct extraction of membrane proteins with surrounding lipids

  • Protein engineering approaches:

    • Create fusion constructs with solubilizing partners (MBP, SUMO)

    • Remove flexible regions identified by disorder prediction algorithms

    • Introduce stabilizing mutations based on structural information

  • Purification workflow optimization:

    • Use affinity chromatography followed by size exclusion chromatography

    • Incorporate quality control steps (dynamic light scattering, thermal stability assays)

    • Optimize buffer conditions (pH, salt, glycerol content)

The experimental design should include appropriate functional assays to verify that the purified protein retains its native activity, especially its ability to form homodimers and participate in SNARE complex assembly .

How can apparent contradictions in SEC22c localization or function across different experimental systems be resolved?

Researchers occasionally encounter contradictory results regarding SEC22c localization, interactions, or function depending on the experimental system used. To address these discrepancies:

  • Systematic comparison of experimental conditions:

    • Conduct parallel experiments in multiple cell types or expression systems

    • Standardize detection methods and quantification approaches

    • Control for expression levels, as overexpression can lead to mislocalization

  • Combined methodological approaches:

    • Apply multiple complementary techniques to the same biological question

    • For localization studies, combine subcellular fractionation with immunofluorescence and immuno-EM

    • For interaction studies, use both in vitro reconstitution and cellular approaches

  • Consider biological variables:

    • Cell-type specific differences in SEC22c regulation or interacting partners

    • Cell cycle dependence of SEC22c function or localization

    • Influence of cellular stress conditions on SEC22c behavior

  • Data integration and reproducibility assessment:

    • Apply statistical methods appropriate for heterogeneous data integration

    • Evaluate the reproducibility of findings across laboratories using meta-analysis approaches

    • Consider pre-registering experimental designs to enhance transparency

This systematic approach follows principles of rigorous experimental design and can help reconcile apparently contradictory findings to develop a more comprehensive understanding of SEC22c biology .

What are the current limitations in studying SEC22c function and how might these be addressed in future research?

Current research on SEC22c faces several methodological and conceptual limitations that future studies should address:

  • Temporal resolution limitations:

    • SNARE-mediated membrane fusion events occur on millisecond timescales, challenging to capture with conventional imaging

    • Solution: Develop and apply ultra-fast imaging approaches or synchronizable fusion systems

  • Complexity of redundant functions:

    • Multiple SNARE proteins may have overlapping functions, complicating interpretation of knockout studies

    • Solution: Apply combinatorial knockdown/knockout approaches and develop more sophisticated conditional systems

  • Structural knowledge gaps:

    • Limited high-resolution structural information on SEC22c in different conformational states

    • Solution: Apply cryo-EM or integrative structural biology approaches to capture different functional states

  • In vivo relevance:

    • Difficulty in translating in vitro findings to physiological contexts

    • Solution: Develop tissue-specific and conditional knockout models, organoid systems, or in situ labeling approaches

  • Technical challenges in membrane protein biochemistry:

    • Maintaining native lipid environments during purification and analysis

    • Solution: Advance native MS techniques, develop improved membrane mimetics, and apply in-cell structural approaches

Addressing these limitations requires interdisciplinary approaches combining advanced imaging, structural biology, genetic engineering, and computational methods .

What statistical approaches are most appropriate for analyzing SEC22c trafficking dynamics data?

Quantitative analysis of SEC22c trafficking dynamics generates complex datasets that require appropriate statistical methods:

  • Time series analysis:

    • Autoregressive integrated moving average (ARIMA) models for temporal patterns

    • Hidden Markov Models (HMMs) to identify discrete states in trafficking processes

    • Change-point detection algorithms to identify significant transitions

  • Spatial statistics:

    • Ripley's K function or nearest neighbor analysis for spatial clustering

    • Object-based colocalization analysis for multi-channel microscopy data

    • Trajectory analysis for single-particle tracking experiments

  • Machine learning approaches:

    • Supervised classification algorithms to identify vesicle types or trafficking events

    • Unsupervised clustering to identify patterns in high-dimensional datasets

    • Deep learning for image analysis and feature extraction

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Mixed-effects models to account for biological and technical variability

    • Multiple testing corrections for high-dimensional data

These approaches should be implemented following rigorous standards for statistical analysis in biological research, ensuring transparency in data processing and analysis pipelines .

How can researchers ensure reproducibility in SEC22c functional studies across different laboratories?

Ensuring reproducibility in SEC22c research requires attention to methodological details and transparent reporting:

  • Standardization of reagents and protocols:

    • Use well-characterized and consistent sources of antibodies and other reagents

    • Develop and share detailed standard operating procedures (SOPs)

    • Consider establishing common reference materials or cell lines

  • Comprehensive reporting:

    • Document all experimental conditions, including buffer compositions, incubation times, and temperatures

    • Report all analysis parameters and software versions

    • Share raw data through appropriate repositories

  • Independent validation:

    • Replicate key findings using different methodological approaches

    • Collaborate with independent laboratories to verify results

    • Consider pre-registration of experimental designs for critical studies

  • Open science practices:

    • Share plasmids, cell lines, and other resources through repositories

    • Publish detailed protocols in dedicated journals or platforms

    • Utilize electronic lab notebooks for enhanced documentation

These practices align with current best practices in reproducible science and address known challenges in research reproducibility .

What are the most promising research directions for understanding SEC22c function in physiological and pathological conditions?

Based on current knowledge of SEC22c biology, several research directions show particular promise:

  • Systems-level understanding:

    • Integrating SEC22c function into comprehensive models of vesicular trafficking networks

    • Exploring cell-type specific roles of SEC22c in specialized secretory systems

    • Investigating SEC22c regulation in response to cellular stress and environmental stimuli

  • Disease relevance:

    • Exploring potential roles of SEC22c dysfunction in neurodegenerative diseases

    • Investigating SEC22c in cancer cell biology, particularly in processes requiring enhanced secretion

    • Examining SEC22c function in immune cell responses and inflammation

  • Therapeutic applications:

    • Evaluating SEC22c as a potential drug target for modulating secretory pathway activity

    • Developing tools to specifically manipulate SEC22c function with temporal precision

    • Exploring SEC22c-mediated pathways in regenerative medicine applications

  • Technological innovations:

    • Development of SEC22c-specific biosensors for real-time trafficking analysis

    • Application of genome-wide approaches to map SEC22c genetic interactions

    • Integration of multi-omics data to understand SEC22c in cellular networks

These directions represent opportunities for significant advances in understanding fundamental cellular processes while potentially opening new therapeutic avenues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.