Recombinant Mouse Vesicle transport protein SFT2A (Sft2d1)

What is Vesicle Transport Protein SFT2A (Sft2d1) and what are its key characteristics?

Vesicle Transport Protein SFT2A (Sft2d1) is a 159-amino acid protein that plays a crucial role in vesicular trafficking processes. The mouse variant (UniProt ID: Q5SSN7) functions as a vesicle transport protein with membrane localization characteristics. The protein contains the following amino acid sequence: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSLLG . Its conserved domain structure suggests functional similarity across species, with human SFT2D1 (also known as C6ORF83 or PRGR1) serving homologous cellular functions .

What expression systems are recommended for producing recombinant mouse Sft2d1?

E. coli expression systems are predominantly used for recombinant production of mouse Sft2d1 protein. The bacterial expression platform is particularly effective when the protein is fused to an N-terminal His tag to facilitate purification, yielding purity levels exceeding 90% as determined by SDS-PAGE analysis . While E. coli remains the standard expression system, researchers should consider that post-translational modifications present in mammalian cells may not be reproduced in bacterial systems, which could affect certain functional studies. For applications requiring native post-translational modifications, alternative mammalian expression systems might be preferable, though these typically yield lower protein quantities.

What are the optimal storage conditions for recombinant mouse Sft2d1 protein?

Recombinant mouse Sft2d1 protein should be stored at -20°C/-80°C upon receipt, with proper aliquoting to prevent repeated freeze-thaw cycles which can significantly degrade protein integrity. The protein is typically supplied in lyophilized form and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For enhanced stability, addition of 5-50% glycerol (with 50% being standard practice) to the reconstituted protein is recommended. Working aliquots can be stored at 4°C for up to one week, but longer storage requires freezing at -20°C/-80°C . It's critical to note that the protein stability can be compromised by repeated freezing and thawing, so single-use aliquots are strongly advised for research applications requiring consistent protein quality.

What reconstitution protocols yield optimal activity for recombinant mouse Sft2d1?

For optimal reconstitution of lyophilized recombinant mouse Sft2d1 protein, a systematic approach is required:

• Centrifuge the vial briefly before opening to ensure all content is at the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (standardly 50%) for stability

• Prepare single-use aliquots to prevent protein degradation from freeze-thaw cycles

• Store working solutions at 4°C (stable for approximately one week)

• Store long-term aliquots at -20°C/-80°C

This protein is typically maintained in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . The addition of trehalose serves as a cryoprotectant and helps maintain protein integrity during freezing. When designing experiments, allow the protein to equilibrate to room temperature before use, and avoid vortexing, which can cause protein denaturation.

How can researchers validate the functionality of recombinant mouse Sft2d1?

Validation of recombinant mouse Sft2d1 functionality requires multiple complementary approaches:

• Structural integrity assessment:

  • SDS-PAGE analysis to confirm size and purity (>90% purity expected)

  • Circular dichroism spectroscopy to verify proper protein folding

• Interaction studies:

  • Protein-protein interaction assays to confirm binding to known partners

  • Co-immunoprecipitation with vesicular transport machinery components

  • Y2H (yeast two-hybrid) screening to identify interacting proteins

• Functional assays:

  • Vesicle trafficking assays in relevant cell models

  • Membrane fractionation to confirm proper localization

The validation should incorporate positive controls (known functional variants) and negative controls (heat-denatured protein) to establish assay specificity. For comprehensive validation, researchers should consider orthogonal validation methods such as MAPPIT (Mammalian Protein-Protein Interaction Trap), which can confirm interactions identified in primary screens .

What cell lines are most appropriate for studying mouse Sft2d1 function?

Selection of appropriate cell lines for studying mouse Sft2d1 function should be guided by experimental objectives and physiological relevance:

Expression analysis data from the Allen Brain Atlas and other databases indicate substantial expression of SFT2D1 in multiple brain tissues, suggesting that neuronal cell lines may be particularly relevant for studying its physiological functions . When selecting cell models, researchers should consider the expression levels of endogenous Sft2d1 and potential redundancy with other SFT2 family members, which might necessitate knockdown approaches to observe clear phenotypes.

How does mouse Sft2d1 interact with other components of the vesicular transport machinery?

Mouse Sft2d1 functions within a complex network of vesicular transport proteins. Research suggests it plays a role in the post-Golgi transport mechanisms, potentially interacting with several components:

• SNARE proteins: Sft2d1 may interact with SNARE complex components that facilitate membrane fusion events

• Rab GTPases: Functional associations with specific Rab proteins that regulate vesicle trafficking steps

• Tethering factors: Potential cooperation with tethering complexes that mediate initial vesicle-target interactions

Protein interaction mapping studies have demonstrated that vesicular transport proteins often have multiple interaction partners, forming networks that determine trafficking specificity . Detailed interaction mapping requires multiple complementary approaches including co-immunoprecipitation, proximity labeling techniques (BioID, APEX), and validation through orthogonal assays such as MAPPIT. Interaction strength appears to correlate with detection frequency in screening assays, with stronger interactions being identified more consistently across multiple screens .

What are the implications of Sft2d1 mutations in cellular homeostasis and disease models?

Research on Sft2d1 mutations suggests potential implications for cellular homeostasis and disease processes:

• Trafficking defects: Mutations may disrupt vesicular transport pathways, affecting protein and lipid distribution within cells

• Organelle integrity: Alterations in Sft2d1 function could impact Golgi morphology and function

• Secretory pathway defects: Compromised protein secretion may result from Sft2d1 dysfunction

• Neurological implications: Given the expression pattern in brain tissues, mutations might have neurological consequences

SFT2D1 has over 3,000 functional associations across multiple biological categories, suggesting its dysfunction could have widespread effects . Advanced disease modeling approaches include:

• CRISPR/Cas9-mediated gene editing to introduce specific mutations

• Patient-derived induced pluripotent stem cells (iPSCs) differentiated into relevant cell types

• Conditional knockout mouse models to study tissue-specific effects

When designing disease models, researchers should consider potential compensatory mechanisms by other SFT2 family members that might mask phenotypes in acute knockout studies.

How can high-throughput proteomic approaches be applied to elucidate Sft2d1 interactome?

High-throughput proteomic approaches offer powerful tools for comprehensively mapping the Sft2d1 interactome:

• Affinity purification-mass spectrometry (AP-MS):

  • Tag recombinant Sft2d1 with epitope tags (His, FLAG, etc.)

  • Perform pull-down followed by mass spectrometry

  • Analyze data using computational tools to filter out non-specific binders

• Proximity labeling techniques:

  • BioID: Fusion of Sft2d1 with biotin ligase to label proximal proteins

  • APEX: Peroxidase-based labeling of proteins in proximity to Sft2d1

  • Quantitative analysis to identify true interactors versus background

• Complementary Y2H screening:

  • Multiple Y2H assay versions to maximize detection coverage

  • Verification through pairwise testing and sequence confirmation

  • Validation using orthogonal assays such as MAPPIT

Research has shown that combining multiple screening approaches significantly increases the number of detected protein-protein interactions, potentially doubling the number of interactions identified compared to a single screening method . For Sft2d1, consideration of membrane topology is critical when designing fusion constructs for interaction screening, as improper orientation can mask interaction domains.

What are the common obstacles in producing functional recombinant mouse Sft2d1 and how can they be overcome?

Researchers frequently encounter several challenges when producing functional recombinant mouse Sft2d1:

• Protein solubility issues:

  • Challenge: Membrane-associated proteins like Sft2d1 often have hydrophobic regions causing aggregation

  • Solution: Optimize expression conditions (temperature reduction to 18-20°C, use specialized E. coli strains)

  • Alternative: Consider fusion tags that enhance solubility (MBP, SUMO) in addition to His-tag

• Proper folding concerns:

  • Challenge: E. coli expression systems may not provide appropriate folding machinery

  • Solution: Co-express with molecular chaperones or use eukaryotic expression systems

  • Validation: Implement functional assays to confirm properly folded protein

• Purification difficulties:

  • Challenge: Membrane proteins can be difficult to extract without denaturation

  • Solution: Use mild detergents during lysis and purification steps

  • Optimization: Test different buffer compositions to enhance stability

How can researchers distinguish between specific and non-specific interactions in Sft2d1 protein-protein interaction studies?

Distinguishing specific from non-specific interactions in Sft2d1 protein-protein interaction studies requires rigorous experimental design and controls:

• Experimental strategies:

  • Perform reverse pull-down experiments (using the putative interactor as bait)

  • Implement concentration-dependent binding assays to establish saturation kinetics

  • Compare wild-type Sft2d1 with mutant variants affecting specific domains

• Control implementations:

  • Unrelated membrane proteins of similar size/topology as negative controls

  • Competition assays with unlabeled proteins to demonstrate specificity

  • Truncation mutants to map interaction domains

• Validation approaches:

  • Use multiple orthogonal techniques (Y2H, co-IP, FRET, etc.)

  • Confirm interactions in multiple screens to increase confidence

  • Apply statistical filters to large-scale interaction datasets

Research has shown that protein-protein interactions detected in multiple screens have higher validation rates in orthogonal assays like MAPPIT, with confirmation rates increasing proportionally to the number of screens in which the interaction was detected . This suggests that interaction strength correlates with detectability, and that weak but specific interactions may require multiple detection attempts.

What technical considerations are important when designing functional assays for Sft2d1?

When designing functional assays for Sft2d1, several technical considerations are critical:

• Vesicular trafficking assays:

  • Use fluorescently labeled cargo proteins to track transport kinetics

  • Implement live-cell imaging with appropriate temporal resolution

  • Consider photoactivatable or photoswitchable proteins for pulse-chase experiments

• Membrane topology considerations:

  • Ensure fusion tags don't interfere with membrane insertion

  • Verify proper orientation using protease protection assays

  • Consider the impact of detergents on protein structure and function

• Functional complementation:

  • Design rescue experiments in knockdown/knockout systems

  • Include appropriate negative controls (inactive mutants)

  • Quantify restoration of function using objective metrics

• Physiological relevance:

  • Use physiologically relevant expression levels to avoid artifacts

  • Consider the impact of cell type and culture conditions

  • Validate findings in multiple cell systems where possible

For assay development, researchers should note that Sft2d1 is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , which should be considered when designing buffer systems for in vitro functional assays to maintain protein stability and native conformation.

How does Sft2d1 expression pattern vary across tissues and what are the functional implications?

Analysis of Sft2d1 expression patterns reveals tissue-specific distribution with important functional implications:

• Expression pattern data:

  • Brain tissues show significant expression patterns based on Allen Brain Atlas data

  • Developmental and adult tissue expression profiles differ, suggesting stage-specific roles

  • Expression levels vary across brain regions, indicating region-specific functions

• Functional correlations:

  • Tissue-specific expression patterns suggest specialized vesicular transport requirements

  • Co-expression with tissue-specific cargo proteins implies collaborative functional roles

  • Developmental regulation suggests critical roles during organ formation and maturation

• Regulatory mechanisms:

  • Tissue-specific promoters and enhancers likely control differential expression

  • Alternative splicing may generate tissue-specific isoforms with distinct functions

  • Epigenetic modifications may contribute to developmental and tissue-specific expression patterns

Understanding these expression patterns aids in selecting appropriate model systems for functional studies and provides insight into potential tissue-specific phenotypes when Sft2d1 function is disrupted. The high expression in brain tissues suggests particularly important roles in neuronal function and potentially in neurodevelopmental or neurodegenerative processes .

What evolutionary insights can be gained from comparative analysis of Sft2d1 across species?

Comparative analysis of Sft2d1 across species provides valuable evolutionary insights:

• Sequence conservation:

  • Core functional domains show high conservation, indicating essential functions

  • Species-specific variations may reflect adaptation to specialized trafficking needs

  • Conservation patterns can identify critical functional residues for targeted mutation studies

• Functional divergence:

  • Expansion of SFT2 family members in higher organisms suggests functional specialization

  • Paralogs like SFT2D2 and SFT2D3 may have evolved distinct but related functions

  • Species-specific interaction partners may drive functional adaptation

• Evolutionary pressure:

  • Patterns of positive and negative selection across the protein sequence reveal functional constraints

  • Analysis of synonymous vs. non-synonymous mutations indicates selective pressure

  • Comparative analysis across diverse species can pinpoint universally conserved functions

The human homolog of mouse Sft2d1 shares significant sequence and functional similarity, making mouse models relevant for studying human disease implications . The evolutionary conservation of this protein across diverse species underscores its fundamental importance in cellular transport processes throughout eukaryotic evolution.

What are the potential applications of recombinant Sft2d1 in developing targeted therapeutics?

Recombinant Sft2d1 presents several potential applications for therapeutic development:

• Drug delivery systems:

  • Understanding Sft2d1's role in vesicular transport could inform design of targeted delivery vehicles

  • Peptides derived from functional domains might modulate specific trafficking pathways

  • Engineered Sft2d1 variants could potentially direct therapeutic cargo to specific cellular compartments

• Therapeutic target identification:

  • Mapping the Sft2d1 interactome may reveal novel therapeutic targets

  • Small molecule screens could identify modulators of Sft2d1 function or interactions

  • Structure-based drug design targeting Sft2d1-interactor interfaces

• Biomarker development:

  • Altered Sft2d1 expression or modification patterns may serve as disease biomarkers

  • Diagnostic applications based on trafficking defects in patient-derived samples

  • Monitoring treatment response through normalization of trafficking pathways

Research into membrane trafficking proteins has increasingly recognized their potential as therapeutic targets, particularly in diseases involving protein misfolding, secretory pathway dysfunction, or organelle homeostasis disruption. The extensive functional associations of SFT2D1 across multiple biological categories (3,020 associations spanning 8 categories) suggest broad potential applications in various disease contexts.