Recombinant Mouse Visual pigment-like receptor peropsin (Rrh)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Mouse Visual pigment-like receptor peropsin (Rrh) refers to a genetically engineered version of the protein encoded by the Rrh gene in mice. Peropsin is a non-visual opsin, a subclass of G protein-coupled receptors (GPCRs), and shares structural and functional similarities with visual pigments like rhodopsin but lacks phototransduction roles. Its primary function in mammals is linked to retinoid metabolism in the retinal pigment epithelium (RPE), where it facilitates the transport of vitamin A derivatives .

Localization and Expression

Peropsin is exclusively expressed in the retinal pigment epithelium (RPE), localized to the apical microvilli that interdigitate with photoreceptor outer segments . This positioning suggests a role in monitoring retinoid concentrations or facilitating their transport between photoreceptors and the RPE.

Key Observations:

  • mRNA Distribution: Restricted to the RPE; absent in photoreceptors and nonocular tissues .

  • Protein Detection: Immunoreactivity confirmed via electron microscopy in RPE microvilli, with molecular weight ~38 kDa (unglycosylated: 37 kDa) .

Functional Role in Vitamin A Metabolism

Knockout studies (Rrh−/− mice) reveal peropsin’s critical role in retinoid dynamics:

  • Increased all-trans-retinol (all-trans-ROL) in the neural retina post-photobleach (~2-fold higher than wild-type) .

  • Reduced retinyl esters in the RPE (~5-fold lower), indicating impaired storage or transport .

  • Phenotypic Similarity: Comparable to mice lacking interphotoreceptor retinoid-binding protein (IRBP) or cellular retinol-binding protein (CRBP), suggesting overlapping roles in retinoid trafficking .

ParameterWild-TypeRrh−/−
Neural Retina all-trans-ROLBasal2× increase
RPE Retinyl EstersHigh5× decrease

Recombinant Protein Studies

Efforts to reconstitute recombinant peropsin in heterologous systems (e.g., transfected 293 cells or baculovirus-infected Sf9 cells) have faced challenges:

  • Retinal Binding: No successful reconstitution with retinal isomers (11-cis- or all-trans-retinal) reported, limiting functional characterization .

  • G Protein Coupling: No evidence of light-dependent signaling or G protein activation, contrasting with classical visual pigments .

Hypothesized Mechanisms:

  1. Retinoid Sensor: May monitor all-trans-retinal levels without phototransduction.

  2. Regulatory Role: Could modulate RPE phagocytosis or retinoid storage via ligand-dependent conformational changes .

Comparative Analysis with Related Proteins

Peropsin belongs to the RGR/retinochrome branch of the visual pigment family, diverging from classical opsins like rhodopsin and cone pigments :

ProteinLigandLocalizationFunction
Rhodopsin11-cis-retinalPhotoreceptor outer segmentsLight detection
RGRall-trans-retinalRPE intracellular membranesRetinal isomerization or signaling
PeropsinHypothetical retinalRPE microvilliRetinoid transport regulation

Genetic and Evolutionary Context

  • Chromosomal Location: Mouse Rrh maps to chromosome 3 (linked to Egf and Nfkb1) .

  • Orthologs: Human peropsin is on chromosome 4q25, sharing intron structure with RGR opsins .

  • Evolutionary Divergence: Peropsin and RGR opsins form a distinct clade, suggesting ancient roles in retinoid metabolism .

Research Gaps and Future Directions

  1. Ligand Specificity: Confirm whether peropsin binds retinal or other retinoids.

  2. Signaling Pathways: Identify potential G protein partners or downstream effectors.

  3. Disease Implications: Explore links to retinal degeneration or vitamin A deficiency disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
Rrh; Visual pigment-like receptor peropsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Rrh
Target Protein Sequence
MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPT NAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVA MDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR NNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTK MSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKK FRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI
Uniprot No.

Target Background

Function
Peropsin may play a role in retinal pigment epithelium (RPE) physiology, either by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds.
Gene References Into Functions
  1. Mice with a null mutation in the peropsin gene (Rrh) exhibited normal retinal histology, normal morphology of outer segments and RPE cells, and no evidence of photoreceptor degeneration. Biochemically, Rrh-/- mice had approximately 2-fold higher vitamin A (all-trans-retinol) in the neural retina following a photobleach. PMID: 29109151
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Found only in the eye, where it is localized to the retinal pigment epithelium (RPE). In the RPE, it is localized to the microvilli that surround the photoreceptor outer segments.

Q&A

What is peropsin and how was it initially identified?

Peropsin (encoded by the Rrh gene) is a visual pigment-like protein belonging to the G protein-coupled receptor superfamily. It was first identified through large-scale sequencing of cDNAs derived from human ocular tissues. Structurally, peropsin shows significant homology to vertebrate and invertebrate visual pigments, with its sequence containing a lysine at the position corresponding to Lys-296 in bovine rhodopsin, which is the site of covalent attachment of retinal chromophore . Unlike traditional visual opsins in photoreceptors, peropsin is specifically localized to the RPE, suggesting distinct physiological functions.

What is the cellular and subcellular localization pattern of peropsin?

Peropsin exhibits a highly specific expression pattern, with mRNA detected exclusively in the eye, particularly in the retinal pigment epithelium (RPE) . At the subcellular level, immunohistochemistry and electron microscopy studies demonstrate that peropsin localizes to the apical face of the RPE, predominantly in the microvilli that surround photoreceptor outer segments . This apical microvillar localization places peropsin in close proximity to photoreceptor outer segments, potentially facilitating interactions with retinoids or other photoreceptor-derived compounds. Immunoblot analysis of mouse eye tissue identifies peropsin as a 37-kDa protein that is absent in Rrh−/− knockout mice .

How does peropsin differ from other opsins in the retina?

Peropsin differs from traditional visual opsins in several key aspects. While rhodopsin and cone opsins are expressed in photoreceptor cells and function as light detectors initiating the visual transduction cascade, peropsin is expressed exclusively in the RPE . Additionally, unlike rhodopsin which preferentially binds 11-cis-retinal, peropsin may bind all-trans-retinal, similar to RPE G protein-coupled receptor (RGR) opsin. Peropsin falls within a distinct branch of the visual pigment family, showing some similarities to RGR opsin and squid retinochrome, though the blast alignment indicates greater similarity to visual pigments than to RGR or retinochrome .

How can researchers generate and validate Rrh knockout mouse models?

Researchers can generate Rrh−/− mice through homologous recombination in embryonic stem cells. The knockout design typically involves replacing portions of the Rrh gene with a targeting construct containing selection markers . The targeting strategy should disrupt the coding sequence, particularly the crucial transmembrane domains or the retinal-binding lysine residue.

Validation of successful gene targeting requires:

  • Southern blot analysis to confirm homologous recombination

  • PCR genotyping of offspring to identify heterozygous and homozygous animals

  • Immunoblot analysis of RPE homogenates to confirm absence of the 37-kDa peropsin protein

  • Immunohistochemistry of eyecup sections to verify the absence of peropsin immunofluorescence at the apical RPE surface

What are the optimal methods for studying retinoid dynamics in peropsin research?

To investigate retinoid dynamics in relation to peropsin function, researchers should employ HPLC-based quantification of visual retinoids from precisely dissected neural retinas and RPE tissues. The protocol should include:

  • Carefully controlled light conditions:

    • Dark adaptation (typically overnight)

    • Light exposure protocols with defined intensity and duration

    • Recovery periods in darkness at various timepoints

  • Tissue preparation:

    • Rapid dissection under dim red light for dark-adapted samples

    • Immediate freezing of samples on dry ice

    • Separate analysis of neural retina and RPE fractions

  • Retinoid extraction and analysis:

    • Extraction with organic solvents

    • HPLC separation with appropriate columns and mobile phases

    • Quantification against known standards

    • Analysis of multiple retinoid species (11-cis-RAL, all-trans-RAL, all-trans-ROL)

Comparisons between wild-type and Rrh−/− mice under these controlled conditions can reveal specific defects in retinoid processing or transport.

What techniques are most effective for characterizing peropsin's subcellular localization?

For precise subcellular localization of peropsin, a multi-level microscopy approach is recommended:

  • Immunofluorescence and immunoperoxidase staining using affinity-purified antibodies against peropsin-specific peptides (preferably from the C-terminal region)

  • Confocal microscopy to visualize the distribution pattern within RPE microvilli

  • Immunogold staining of plastic sections (1 μm) to achieve higher resolution localization

  • Postembedding immunoelectron microscopy on ultra-thin sections to determine:

    • Precise membrane association (apical plasma membrane)

    • Microvillar distribution pattern

    • Spatial relationship to photoreceptor outer segments

    • Absence from rod outer segments and other cellular compartments

This comprehensive approach provides definitive evidence for the specific localization of peropsin to the apical microvilli of the RPE.

What is the evidence for peropsin's retinoid-binding capabilities?

The retinoid-binding capacity of peropsin is supported by several lines of evidence:

  • Sequence homology: Peropsin contains a lysine residue at position 284 (corresponding to Lys-296 in bovine rhodopsin), which is the site for Schiff base formation with retinal .

  • Structural features: Peropsin shares key structural features with other retinal-binding proteins in the visual pigment family, including conserved transmembrane domains and critical amino acid residues .

  • Experimental evidence: Studies suggest peropsin binds all-trans-RAL in the dark and may convert it to 11-cis-RAL upon light exposure, potentially functioning as a photoisomerase .

  • Knockout phenotype: Rrh−/− mice show alterations in retinoid metabolism, particularly in the movement of all-trans-ROL between retina and RPE, consistent with a role in retinoid handling .

These findings collectively suggest that peropsin likely functions as a retinoid-binding protein, though its precise role in retinoid isomerization or transport requires further investigation.

How might peropsin interact with the visual cycle pathway?

Peropsin may interact with the visual cycle through several potential mechanisms:

  • Regulation of all-trans-ROL movement: Knockout studies suggest peropsin controls all-trans-ROL movement from the retina to the RPE or regulates all-trans-ROL storage within the RPE .

  • Light-dependent regulation: Peropsin may affect light-dependent regulation of all-trans-ROL uptake from photoreceptors into RPE cells through an as yet undefined mechanism .

  • Potential photoisomerase activity: Similar to RGR opsin and squid retinochrome, peropsin might function as a photoisomerase, converting all-trans-RAL to 11-cis-RAL upon light exposure, thereby contributing to visual pigment regeneration .

  • G protein-coupled signaling: As a member of the G protein-coupled receptor superfamily, peropsin might activate signaling pathways in the RPE that indirectly modulate visual cycle enzyme activities or membrane transport processes .

The strategic localization of peropsin in RPE microvilli, positioned at the interface between photoreceptors and RPE, supports its potential role in mediating retinoid transfer between these cell types.

What signaling pathways might peropsin activate in the RPE?

As a G protein-coupled receptor homolog, peropsin potentially interacts with G proteins to activate downstream signaling cascades, although specific pathways remain to be elucidated. Potential signaling mechanisms include:

  • G protein coupling: Peropsin may couple with Gq or another G protein subtype to activate phospholipase C, leading to production of inositol trisphosphate and diacylglycerol, and subsequent calcium mobilization .

  • Light-dependent signaling: Peropsin might function as a light receptor that signals in response to photoisomerization of a bound chromophore, potentially regulating RPE functions in a light-dependent manner .

  • Retinoid-dependent signaling: Alternatively, peropsin could be activated or inactivated by binding to specific retinal isomers without requiring illumination, serving as a sensor for retinoid levels .

  • Regulation of membrane transport: Signaling initiated by peropsin might modulate the activity of transporters involved in retinoid movement across the RPE-photoreceptor interface .

Further studies using pharmacological approaches and cell-based assays are needed to definitively characterize peropsin's signaling capabilities.

How does peropsin contribute to retinoid homeostasis between the retina and RPE?

Based on knockout studies, peropsin appears to play a significant role in maintaining retinoid homeostasis between the neural retina and RPE. Specifically:

  • Vitamin A transport modulation: Peropsin likely modulates the movement of vitamin A (as all-trans-ROL) from the retina to the RPE and/or modulates storage of vitamin A within the RPE .

  • Light-dependent regulation: The effect of peropsin on retinoid dynamics appears to be light-dependent, suggesting it may help coordinate retinoid metabolism with ambient light conditions .

  • Interface function: Its strategic localization in RPE microvilli positions peropsin at the critical interface for retinoid exchange between photoreceptors and RPE cells, where it may facilitate or regulate transport processes .

  • RPE physiological regulation: Through its potential signaling capabilities, peropsin might coordinate broader aspects of RPE physiology related to the visual cycle, including enzyme activities or membrane transport processes .

Quantitative analysis of retinoid levels in wild-type versus Rrh−/− mice under different light conditions provides the strongest evidence for peropsin's role in retinoid homeostasis.

What phenotypic changes occur in Rrh−/− mice related to visual function?

Studies of Rrh−/− mice have revealed several phenotypic changes related to retinoid metabolism and potentially visual function:

  • Retinoid processing: Knockout mice show alterations in the dynamics of visual retinoids, particularly affecting the movement of all-trans-ROL between the retina and RPE or storage within the RPE .

  • Light sensitivity: The phenotype appears to be light-dependent, suggesting an interaction with the visual cycle's response to changing light conditions .

  • Structural preservation: Interestingly, loss of peropsin does not affect distal retinal histology or the ultrastructure of photoreceptor outer segments and RPE cells, indicating that peropsin is not essential for maintaining retinal architecture .

  • Functional subtlety: The phenotype may be relatively subtle under standard conditions, becoming more apparent under specific light challenges or when combined with other visual cycle deficiencies .

These observations suggest peropsin plays a modulatory rather than essential role in visual function, potentially becoming more critical under certain physiological challenges or in combination with other genetic factors.

How does peropsin function compare with RGR opsin in the visual cycle?

Peropsin and RGR opsin represent two distinct non-visual opsins expressed in the RPE with potential roles in the visual cycle:

Understanding the precise functional relationship between these two RPE-expressed opsins remains an important area for further investigation.

Is peropsin (RRH) involved in inherited retinal diseases?

Current evidence suggests that mutations in the RRH gene encoding peropsin are not a frequent cause of inherited retinal diseases:

Based on current evidence, RRH is not considered a major causative gene for retinitis pigmentosa or other common inherited retinal dystrophies .

How might altered peropsin function potentially contribute to retinal pathology?

Although RRH mutations have not been directly linked to human retinal diseases, theoretical considerations suggest potential pathological implications:

  • Disrupted retinoid homeostasis: Since peropsin appears to regulate all-trans-ROL movement between retina and RPE, dysfunction could potentially lead to retinoid imbalances affecting visual cycle efficiency .

  • Impaired RPE-photoreceptor interaction: Peropsin's localization in RPE microvilli suggests it may participate in RPE-photoreceptor communication; disruption could potentially affect this critical cellular interface .

  • Modifier gene effects: Rather than causing disease directly, RRH variants might modify the severity or progression of retinal diseases caused by mutations in other visual cycle genes .

  • Stress vulnerability: Peropsin dysfunction might increase vulnerability to light-induced or oxidative stress, potentially contributing to age-related retinal pathologies .

  • Combined genetic effects: While RRH mutations alone may not cause disease, they might contribute to pathology when combined with mutations in other genes involved in retinoid metabolism or RPE function .

Further research using animal models that combine peropsin deficiency with other visual cycle defects could help clarify these potential pathological mechanisms.

What are the most promising approaches for elucidating peropsin's precise biochemical mechanisms?

Advanced biochemical and structural approaches to clarify peropsin's mechanisms should include:

  • Recombinant protein expression and purification:

    • Expression in mammalian cell systems with appropriate post-translational modifications

    • Purification strategies maintaining protein stability and function

    • Reconstitution with various retinoid ligands

  • Spectroscopic characterization:

    • Absorption spectroscopy under varying light conditions

    • Resonance Raman spectroscopy to examine chromophore-protein interactions

    • Fluorescence spectroscopy to monitor conformational changes

  • Retinoid isomerization assays:

    • Light-dependent isomerization of bound retinoids

    • Quantification of retinoid isomer interconversion rates

    • Comparison with RGR opsin and retinochrome activities

  • Structural determination:

    • X-ray crystallography or cryo-EM of ligand-bound and unbound states

    • Site-directed mutagenesis of key residues (especially Lys284)

    • Molecular dynamics simulations of retinoid binding and protein conformational changes

  • G-protein coupling assays:

    • Identification of G-protein subtypes that interact with peropsin

    • Measurement of downstream signaling activities

    • Comparison of signaling properties in light versus dark conditions

How can researchers best investigate peropsin's potential interactions with other visual cycle proteins?

To investigate peropsin's interactions with visual cycle components, researchers should employ:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation from native RPE tissue

    • Proximity labeling approaches (BioID, APEX) in RPE cells

    • FRET or BRET assays in reconstituted systems

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Visual cycle enzyme activity assays:

    • Measurement of key enzyme activities (RPE65, LRAT, RDH5) in wild-type versus Rrh−/− tissues

    • Effects of recombinant peropsin on enzyme kinetics in vitro

    • Temporal analysis of enzyme activities following light exposure

  • Membrane microdomain analysis:

    • Isolation of lipid rafts and membrane microdomains

    • Proteomic profiling of peropsin-containing membrane fractions

    • Analysis of retinoid distribution in membrane compartments

  • Combined genetic approaches:

    • Generation of double knockout models (e.g., Rrh−/− with Rgr−/−)

    • Crossbreeding with visual cycle enzyme mutants

    • Analysis of synthetic phenotypes in combined mutants

These approaches would help establish whether peropsin functions independently or as part of a larger protein complex in the visual cycle.

What computational modeling approaches can enhance understanding of peropsin structure-function relationships?

Advanced computational approaches can provide valuable insights into peropsin's structure and function:

  • Homology modeling and molecular dynamics:

    • Development of accurate 3D structural models based on crystallized GPCR templates

    • Refinement through molecular dynamics simulations in membrane environments

    • Analysis of retinoid binding pocket dynamics and accessibility

  • Ligand docking and binding energy calculations:

    • Virtual screening of various retinoid isomers

    • Calculation of binding energies and identification of key interaction residues

    • Prediction of light-dependent conformational changes

  • Evolutionary analysis:

    • Comprehensive phylogenetic analysis across species

    • Identification of evolutionarily conserved functional motifs

    • Comparative analysis with visual opsins, RGR opsin, and retinochrome

  • Protein-protein interaction prediction:

    • Identification of potential G-protein binding interfaces

    • Prediction of interactions with visual cycle proteins

    • Modeling of multiprotein complexes at the RPE-photoreceptor interface

  • Systems biology approaches:

    • Integration of peropsin into visual cycle pathway models

    • Prediction of system-level effects of peropsin modulation

    • Simulation of light-dependent retinoid flux between retina and RPE

These computational approaches, validated through experimental testing, can guide hypothesis generation and experimental design for peropsin research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.