Recombinant Mouse Vitamin K-dependent gamma-carboxylase (Ggcx)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant mouse vitamin K-dependent gamma-carboxylase (Ggcx) is an engineered form of the enzyme responsible for post-translational gamma-carboxylation of glutamate residues in vitamin K-dependent proteins (VKDPs). This modification enables VKDPs to bind calcium, a critical step for their biological functions in blood coagulation, bone metabolism, and vascular calcification . Ggcx is a 758-amino acid integral membrane protein with five transmembrane domains and catalytic regions localized in the endoplasmic reticulum lumen .

Mechanism of Action

Ggcx catalyzes two reactions:

  1. Vitamin K epoxidation: Oxidation of reduced vitamin K (KH₂) to vitamin K epoxide (KO).

  2. Glutamate carboxylation: Conversion of glutamate (Glu) to γ-carboxyglutamate (Gla) using CO₂ .
    The process requires tight binding between Ggcx and the substrate’s propeptide, which enhances enzymatic activity by up to 100-fold .

Mouse Knockout Studies

Study ModelPhenotypeKey Findings
Ggcx scKO (Sertoli cell-specific knockout)Infertility, seminiferous tubule atrophy, abnormal sperm morphologyReduced connexin 43 expression in Sertoli cells; apoptosis in spermatids .
Liver-specific Ggcx knockoutCoagulation defects, reduced clotting factor activity90% decrease in hepatic Ggcx activity; no spontaneous bleeding .

Clinical Relevance of Ggcx Mutations

Mutations in Ggcx are linked to:

  • Bleeding disorders: Impaired carboxylation of coagulation factors (e.g., prothrombin, FIX) .

  • Non-bleeding syndromes: Keutel syndrome (vascular calcification) and PXE-like syndrome (ectopic mineralization) .

MutationFunctional ImpactClinical Phenotype
D153G60% reduction in coagulation factor carboxylation; abolished MGP carboxylationCerebral bleeding + Keutel syndrome
L394RDefective glutamate bindingVitamin K-dependent clotting factor deficiency

Applications in Therapeutic Development

Recombinant mouse Ggcx is pivotal for:

  • Drug screening: Identifying vitamin K antagonists or enhancers .

  • Gene therapy: Correcting carboxylation defects in coagulation disorders .

  • Mechanistic studies: Resolving allosteric regulation of dual enzymatic activities .

Future Directions

  1. Structural dynamics: Elucidate real-time conformational changes during carboxylation using advanced cryo-EM .

  2. Tissue-specific targeting: Develop conditional knockout models to study extrahepatic roles of Ggcx .

  3. Therapeutic optimization: Engineer Ggcx variants with enhanced substrate specificity for clotting factors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Ggcx; Vitamin K-dependent gamma-carboxylase; Gamma-glutamyl carboxylase; Peptidyl-glutamate 4-carboxylase; Vitamin K gamma glutamyl carboxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-757
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AVHRGSALVAPASDKVQKNKSAQTSGLKQGSRMEKILGFEWTDLSSWQSVVTLLNKPTDP ANLAVFRFLFAFLMLLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTI MFLGALGMMLGLCYRLSCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWS VDGLLNARKKNAHVPLWNYTVLRGQIFIVYFIAGVKKLDADWVGGYSMEHLSRHWLFSPF KLVLSEELTSLLVVHWCGLLLDLSAGFLLFFDASRPVGLFFVSYFHCMNSQLFSIGMFPY VMLASSPLFCSAEWPRKLVARCPKRLQELLPTKAAPRPSASCVYKRSRGKAGPKPGLRHQ LGAIFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGLTG ELGYLNPGVFTQSRRWKDHADMLKQYATCLSLLLPKYNVTEPQIYFDIWVSINDRFQQRL FDPRVDIVQAVWSPFQRTPWVQPLLMDLSPWRTKLQDIKSSLDNHTEVVFIADFPGLHLE NFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLQEGEKMQLPAGEYHKVYTVSSSPSCYMY VYVNTTEVALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLR RQRKLQEIERRRNSPFHERFLRFVLRKLYVFRRSFLMTRISLRNLLLGRPSLEQLAQEVT YANLRPFEPVDESSASNTDSSNHPSEPDSEHVHSEF
Uniprot No.

Target Background

Function

This protein mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues. This process concurrently converts the reduced hydroquinone form of vitamin K to vitamin K epoxide.

Gene References Into Functions
  1. In osteoblasts, GGCX prevents abnormal mineralization during bone formation. PMID: 25600070
  2. GGCX expression in osteoblasts is crucial for maintaining blood glucose levels and white adipose tissue (WAT). PMID: 25264202
  3. Ggcx(Deltaliver/Deltaliver) mice exhibited bleeding diathesis. PMID: 24520408
  4. Studies explore the impact of vitamin K-dependent protein precursor propeptide, vitamin K hydroquinone, and glutamate substrate binding on the structure and function of gamma-glutamyl carboxylase. PMID: 20716530
  5. Findings suggest a role for both the GGCX gene and genetic background, as well as dietary factors, in modulating the phenotypic severity of Pseudoxanthoma elasticum caused by ABCC6 loss-of-function mutations. PMID: 19784827
  6. Analysis of a Ggcx(+/-) intercross revealed a partial developmental block, with only 50% of expected Ggcx(-/-) offspring surviving to term. These animals died at birth due to massive intra-abdominal hemorrhage. PMID: 17327402
Database Links
Protein Families
Vitamin K-dependent gamma-carboxylase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of GGCX in post-translational modification?

GGCX is the sole enzyme responsible for catalyzing the carboxylation of glutamate (Glu) to γ-carboxyglutamate (Gla) in vitamin K-dependent proteins (VKDPs). This post-translational modification occurs in the endoplasmic reticulum and requires reduced vitamin K, carbon dioxide, and oxygen as co-factors . The carboxylation reaction is critical for the biological function of several proteins involved in blood coagulation (prothrombin, FVII, FIX, FX, PC, PS, PZ) and bone metabolism (bone Gla protein, BGP) .

Methodologically, researchers should understand that GGCX functions as part of the vitamin K cycle, where concomitant with VKD carboxylation is the formation of vitamin K 2,3-epoxide (KO) and the catalytic regeneration of vitamin K hydroquinone (KH₂) involving vitamin K epoxide reductase (VKOR) . This interconnected system means that studying GGCX in isolation may not fully reflect its physiological function.

How is GGCX structurally organized to facilitate its function?

Recent cryo-electron microscopy (cryo-EM) studies have revealed that GGCX comprises distinct functional domains:

  • A transmembrane domain (TMD) that anchors the vitamin K-binding site

  • An ER luminal domain that facilitates binding of VKDPs at the exosite

  • A catalytic reaction center that orchestrates both the oxidation of vitamin K and the carboxylation of Glu residues

The enzyme's catalytic center integrates the vitamin K-binding and Gla-binding pockets, forming an interconnected catalytic reaction center . This structural arrangement enables GGCX to couple its dual enzymatic activities through what has been termed a "Cap-H2 coupling mechanism."

What are the most effective systems for studying GGCX function in vitro?

Early research on GGCX utilized crude microsomal extracts or detergent-solubilized liver microsomes from warfarin-treated or vitamin K-deficient animals . While these systems provided valuable initial insights, they had significant limitations.

The development of more sophisticated experimental systems has greatly advanced our understanding of GGCX:

Experimental SystemDescriptionAdvantagesLimitations
FLEEL peptide substrateArtificial peptide substrate (residues 5-9 of rat prothrombin)Simple, readily availableDoes not recapitulate propeptide binding
Propeptide-containing substratesSubstrates with both propeptide sequence and portions of Gla domainBetter mimics natural substratesMay not fully represent cellular environment
Nanodisc-HX MSGGCX embedded in nanodisc phospholipid environment studied with hydrogen exchange mass spectrometryNear-native membrane environmentTechnical complexity
Cell-based reporter assay (FIXgla-PC)Chimeric reporter protein where PC backbone is replaced at N-terminus with FIX Gla domainAllows assessment of entire VKD cycle in native environmentMay be influenced by other cellular factors

For researchers focusing specifically on mouse GGCX, the cell-based reporter assay developed by Tie and Stafford offers distinct advantages as it allows for functional assessment of GGCX in an environment that requires interaction with physiologic substrates .

How can researchers effectively express and purify recombinant mouse GGCX?

When working with recombinant mouse GGCX, researchers should consider:

  • Expression systems: Edited cell lines lacking endogenous carboxylase (such as the fIX 293 cells) provide a clean background for expressing recombinant GGCX constructs .

  • Vector selection: Vectors such as pCMV6-AC with appropriate tags (e.g., FLAG) facilitate purification and detection .

  • Selection strategy: Stable transfectants can be selected using antibiotics like G418 (0.5 mg/ml), followed by screening with anti-carboxylase antibodies .

  • Verification of activity: Functional validation is essential, as mutations or improper folding can eliminate carboxylase activity, as demonstrated with the exon 2 skipping variant .

How does propeptide binding influence GGCX structure and function?

The propeptide region of VKD proteins plays a crucial role in substrate recognition by GGCX. Hydrogen exchange mass spectrometry (HX MS) studies of GGCX in nanodiscs have revealed specific structural rearrangements upon binding of high-affinity consensus propeptide (pCon) .

Key findings include:

  • Propeptide binding promotes enhanced structural stability to the nanodisc-integrated GGCX complex while maintaining catalytic activity .

  • Noteworthy modifications in hydrogen exchange were observed in GGCX peptides 491-507 and 395-401 upon propeptide association, consistent with regions previously identified as sites for propeptide and glutamate binding .

  • Several additional protein regions exhibited minor gains in solvent protection upon propeptide incorporation, providing evidence for a structural reorientation of the GGCX complex during VKD carboxylation .

These findings suggest that propeptide binding induces conformational changes that optimize GGCX for substrate carboxylation, providing insight into the molecular mechanism of this enzyme.

What is the molecular basis for the dual catalytic function of GGCX?

GGCX performs two coupled reactions: oxidation of vitamin K and carboxylation of glutamate residues. Recent structural studies have revealed a mechanism termed "Cap-H2 coupling" that orchestrates these dual catalytic functions .

This mechanism involves:

  • A distinct vitamin K binding pocket embedded within an elongated pocket in the transmembrane domain

  • Close proximity of this pocket to the substrate glutamate residues

  • A hydrogen-bond network stabilizing a structural element called the "Cap"

  • Coupling between the Cap and the H2 helix of the propeptide-binding domain (PBD-2)

Molecular dynamics simulations have confirmed conformational transitions in both the H2 helix and Cap regions, supporting this coupling mechanism . This understanding provides new opportunities for studying how mutations might disrupt this coupling and lead to disease.

How do GGCX mutations impact carboxylation efficiency and what methods best characterize these effects?

Mutations in GGCX can result in diverse clinical phenotypes, including bleeding disorders and non-bleeding symptoms. Cell-based assays provide powerful tools for studying the consequences of naturally occurring mutations .

A notable example is the GGCX D153G mutation, which has been characterized using a cell-based system. Compared to wild-type GGCX, this mutant:

  • Significantly decreased coagulation factor carboxylation

  • Completely abolished matrix Gla protein (MGP) carboxylation at physiological vitamin K concentrations

  • Showed partial restoration (up to 60%) of coagulation factor carboxylation at higher vitamin K concentrations, but no improvement in MGP carboxylation

These findings provided the first evidence of a GGCX mutation resulting in two distinct clinical phenotypes, demonstrating the value of cell-based assays in characterizing mutation effects .

How can differences in propeptide affinity affect carboxylation of different VKD proteins?

Research has revealed that different VKD proteins have varying propeptide affinities for GGCX, which affects their carboxylation efficiency:

  • Factor IX has the highest propeptide affinity, making its propeptide optimal for efficient carboxylation .

  • Propeptide mutations at critical positions (-6 and -10) can significantly alter carboxylation efficiency. For example, enhancing the affinity of bone Gla protein (BGP) propeptide for GGCX by mutating these positions rescued carboxylation .

  • Factor X propeptide binds very tightly to GGCX, and attempts to weaken this binding through mutations at positions -6 and -10 were unsuccessful, suggesting complex binding mechanisms .

  • Mutations in the FIX propeptide (at positions -9 and -10) are associated with warfarin hypersensitivity, demonstrating the clinical relevance of propeptide-GGCX interactions .

For researchers studying different VKD proteins, understanding these propeptide-specific effects is crucial for experimental design and interpretation.

What controls and validations are essential when working with recombinant GGCX?

When conducting experiments with recombinant mouse GGCX, researchers should implement several controls and validation steps:

  • Include both positive controls (wild-type GGCX) and negative controls (inactive GGCX mutants or untransfected cells) in all functional assays .

  • Verify protein expression by Western blotting using anti-carboxylase antibodies .

  • When using nanodisc systems, monitor signature peptic profiles of the membrane scaffold protein (MSP1D1) as a system control for evaluating experimental performance .

  • For structural studies, consider using catalytically inactive mutants (e.g., K217A/K218A) to capture stable ligand-bound states, as demonstrated in cryo-EM studies .

  • When studying propeptide binding, use multiple time points in hydrogen exchange experiments to distinguish between transient and stable conformational changes .

How can researchers address challenges in interpreting data from different experimental systems?

Researchers often face challenges when comparing results from different experimental systems. To address these challenges:

  • Recognize the limitations of artificial peptide substrates like FLEEL, which lack the propeptide component critical for natural substrate recognition .

  • When using cell-based systems, consider that they reflect the entire vitamin K cycle rather than isolated GGCX function, which may be advantageous for physiological relevance but complicates mechanistic interpretation .

  • For purified enzyme studies in detergent or nanodiscs, be aware that the membrane environment may affect enzyme conformation and activity compared to the native ER membrane .

  • When characterizing mutations, correlate in vitro findings with clinical observations when possible, as demonstrated with the D153G mutation study .

By carefully considering these aspects, researchers can better interpret seemingly contradictory results from different experimental approaches and develop a more comprehensive understanding of GGCX function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.