Recombinant Mouse Vitamin K epoxide reductase complex subunit 1-like protein 1 (Vkorc1l1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Vkorc1l1; Vitamin K epoxide reductase complex subunit 1-like protein 1; VKORC1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vkorc1l1
Target Protein Sequence
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVS VVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED
Uniprot No.

Target Background

Function

Recombinant Mouse Vitamin K epoxide reductase complex subunit 1-like protein 1 (VKORC1L1) is involved in vitamin K metabolism. In vitro studies demonstrate its ability to reduce inactive vitamin K 2,3-epoxide to active vitamin K, potentially contributing to vitamin K-mediated protection against oxidative stress. It plays a role in the vitamin K-dependent γ-carboxylation of Glutamic acid (Glu) residues in target proteins.

Gene References Into Functions
  1. mRNA levels of VKORC1, VKORC1L1, GGCX, and NQO1 were quantified, and VKOR enzymatic activities were measured in 29 different tissues. PMID: 25747820
  2. VKORC1L1's involvement in VKOR activity partly explains the reduced susceptibility of certain extrahepatic tissues to vitamin K antagonists. PMID: 23928358
  3. Molecular cloning of VKORC1L1. PMID: 14765194
Database Links
Protein Families
VKOR family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in testis and lung.

Q&A

What is the fundamental role of VKORC1L1 in vitamin K metabolism?

VKORC1L1 functions as a vitamin K oxidoreductase enzyme capable of converting vitamin K epoxide to reduced vitamin K. Like its paralog VKORC1, it can support the vitamin K cycle necessary for γ-carboxylation of vitamin K-dependent proteins. In dithiothreitol (DTT)-driven VKOR activity assays, human and rat VKORC1L1 have been shown to support vitamin K 2,3-epoxide to vitamin K reduction with efficiency comparable to VKORC1 . While VKORC1 is the primary enzyme supporting coagulation factor carboxylation in adult liver, VKORC1L1 has been conclusively demonstrated to support vitamin K-dependent carboxylation in vivo, particularly during pre- and perinatal periods .

The physiological significance of VKORC1L1 is most evident when examining knockout models in combination with VKORC1 deficiency. VKORC1L1 can functionally compensate for VKORC1 deficiency during embryonic development and the perinatal period, explaining why Vkorc1-/- mice survive longer (approximately 1 week) than Ggcx-/- mice (which die during midembryogenesis or at birth) .

How does VKORC1L1 expression compare across different tissues?

VKORC1L1 is broadly expressed across multiple tissues, with expression patterns differing from VKORC1. While both enzymes are widely distributed, Vkorc1l1 mRNA levels are higher than Vkorc1 in certain tissues, particularly brain and testes . Expression analysis in C57BL/6 wild type and VKORC1-deficient mice revealed Vkorc1l1 mRNA in all tissues assayed, including liver, lung, testis, brain, kidney, and osteoblastic cells .

Unlike VKORC1, which shows increasing expression during late embryogenesis and following birth, VKORC1L1 expression remains relatively unchanged during these developmental periods . This differential expression pattern suggests tissue-specific and developmentally regulated roles for these paralogs.

What phenotypes are observed in Vkorc1l1 knockout mice?

Interestingly, Vkorc1l1-/- mice are viable and develop normally compared to wild-type mice . This stands in stark contrast to Vkorc1-/- mice, which die within approximately one week after birth due to severe hemorrhaging. The lack of an obvious phenotype in Vkorc1l1-/- mice under physiological conditions suggests that VKORC1 can fully compensate for VKORC1L1 deficiency in normal development .

What is the relative contribution of VKORC1L1 to VKOR activity in different tissues?

The contribution of VKORC1L1 to total VKOR activity varies significantly between tissues. In P0 livers, VKORC1L1 contributes only about 0.4% of the total VKOR activity compared to wild-type livers, with this percentage dropping to 0.1% in Vkorc1-/-;Vkorc1l1+/- livers . This suggests that in liver, VKORC1 is responsible for over 99% of VKOR activity.

What experimental approaches can be used to differentiate between VKORC1 and VKORC1L1 activities?

Differentiating between VKORC1 and VKORC1L1 activities requires multiple complementary approaches:

  • Genetic models: Utilizing knockout mice (Vkorc1-/-, Vkorc1l1-/-, and double knockouts) allows for the assessment of each enzyme's specific contribution to vitamin K-dependent carboxylation. Analysis of carboxylation in specific tissues at different developmental stages can reveal functional differences .

  • Pharmacological inhibition: VKORC1L1 is approximately 50-fold more resistant to vitamin K antagonists than VKORC1 . This differential sensitivity can be exploited to distinguish their activities by using varying concentrations of inhibitors.

  • Recombinant protein expression systems: Expression of VKORC1 and VKORC1L1 in systems like Pichia pastoris, HEK293T cells, or baculovirus allows for in vitro characterization of their enzymatic properties . These systems facilitate direct comparisons of substrate specificity, enzyme kinetics, and inhibitor sensitivity.

  • Cell-based carboxylation assays: Using reporter proteins (such as Factor IX or Factor X-protein C chimeras) in cell culture systems where VKORC1, VKORC1L1, or both are inactivated provides quantitative measurements of each enzyme's contribution to vitamin K-dependent γ-carboxylation .

How can VKORC1L1 activity be quantitatively measured in tissue samples?

Quantitative measurement of VKORC1L1 activity in tissue samples requires specialized approaches:

  • VKOR activity assay: A specific assay measuring the conversion of vitamin K epoxide to vitamin K can detect VKORC1L1 activity, especially in tissues from Vkorc1-/- animals. This approach has revealed that Vkorc1-/- P0 livers retain approximately 0.4% of normal VKOR activity, attributable to VKORC1L1 .

  • α-Gla Western blot analysis: This technique assesses global vitamin K-dependent protein carboxylation and can indirectly measure VKORC1L1 activity by comparing carboxylation levels in wild-type, Vkorc1-/-, Vkorc1l1-/-, and double knockout tissues .

  • Specific protein carboxylation analysis: Western blot analysis of the carboxylation status of specific vitamin K-dependent proteins (such as prothrombin or GGCX) provides information about VKORC1L1's functional impact .

  • Quantitative PCR: While this measures expression rather than activity, qPCR analysis of Vkorc1l1 mRNA levels relative to Vkorc1 can help interpret activity measurements and explain tissue-specific differences in VKORC1L1 contribution .

What are the biochemical differences between VKORC1 and VKORC1L1 in terms of warfarin sensitivity?

VKORC1L1 exhibits significantly reduced sensitivity to vitamin K antagonists (VKAs) compared to VKORC1. Studies with recombinant proteins have demonstrated that VKORC1L1 is approximately 50-fold more resistant to VKAs than VKORC1 . This differential sensitivity has important pharmacological implications, as it explains why certain vitamin K-dependent processes continue during anticoagulant therapy.

The molecular basis for this differential sensitivity appears to be structural differences between the two enzymes. While both VKORC1 and VKORC1L1 can catalyze vitamin K epoxide reduction, their binding sites for VKAs likely differ, resulting in the observed pharmacological distinction .

Importantly, genetic evidence supports that VKORC1L1 is not the warfarin-resistant vitamin K quinone reductase present in the liver . This indicates that additional mechanisms of warfarin resistance exist beyond VKORC1L1's reduced sensitivity.

How can VKORC1L1 be manipulated to rescue vitamin K-dependent carboxylation in VKORC1-deficient models?

VKORC1L1 overexpression can successfully rescue vitamin K-dependent carboxylation in VKORC1-deficient models, as demonstrated by several experimental approaches:

  • Transgenic expression: Liver-specific expression of FLAG-tagged VKORC1L1 under the control of human APOE gene regulatory sequences (APOE-Vkorc1l1) in Vkorc1-/- mice has successfully rescued carboxylation and hemostasis . Two transgenic lines with approximately 2-fold difference in VKORC1L1-FLAG expression were used to assess dose-dependency of the rescue effect.

  • Expression level requirements: Even when VKORC1L1-FLAG protein expression reached only about 4% of normal VKORC1 levels in wild-type animals, this was sufficient to rescue carboxylation and prothrombin activity in Vkorc1-/- mice . This suggests that relatively modest increases in VKORC1L1 expression can compensate for VKORC1 deficiency.

  • Functional assessment: The efficacy of VKORC1L1 rescue can be evaluated using:

    • Prothrombin time measurements (INR values)

    • Global carboxylation assessment by α-Gla Western blot

    • Specific carboxylation of proteins like prothrombin and GGCX

    • Direct measurement of VKOR activity in liver tissue

What is the developmental regulation of vitamin K-dependent carboxylation and the relative contributions of VKORC1 and VKORC1L1?

Vitamin K-dependent carboxylation is developmentally regulated, with significant changes occurring during late embryogenesis and the perinatal period:

What experimental systems are optimal for studying recombinant mouse VKORC1L1?

Several expression systems have proven effective for studying recombinant mouse VKORC1L1:

  • Pichia pastoris: This yeast expression system has been successfully used to produce recombinant VKORC1L1 for detailed enzyme kinetic studies and inhibitor sensitivity analysis . The system allows for proper folding and membrane insertion of this integral membrane protein.

  • HEK293T cells: Mammalian cell lines like HEK293T provide a eukaryotic environment suitable for studying VKORC1L1 function in a cellular context. Cell-based assays using reporter proteins have been developed to quantitatively measure VKORC1L1-supported γ-carboxylation .

  • In vivo mouse models: Transgenic mice expressing VKORC1L1 under tissue-specific promoters (such as APOE) allow for in vivo assessment of VKORC1L1 function . Combining these with knockout models provides powerful tools for understanding physiological roles.

  • Baculovirus expression systems: While not specifically mentioned for VKORC1L1 in the search results, baculovirus expression has been used for VKORC1 and could potentially be adapted for VKORC1L1 studies .

The choice of expression system should be guided by the specific research questions being addressed, with each system offering distinct advantages for structural, biochemical, or functional studies.

What techniques are essential for measuring VKORC1L1-dependent carboxylation of vitamin K-dependent proteins?

Several complementary techniques are essential for comprehensive assessment of VKORC1L1-dependent carboxylation:

  • α-Gla Western blot analysis: This technique uses antibodies that specifically recognize γ-carboxylated glutamic acid residues, allowing for assessment of global carboxylation status in tissue samples . It provides a qualitative overview of carboxylation levels.

  • Protein-specific carboxylation assays: Western blot analysis using antibodies against specific vitamin K-dependent proteins (such as prothrombin or GGCX) can assess carboxylation status of individual proteins .

  • Functional coagulation assays: Prothrombin time measurements (expressed as International Normalized Ratio, INR) provide a functional assessment of vitamin K-dependent coagulation factor carboxylation . These assays are particularly relevant for studies focused on hemostasis.

  • VKOR activity assay: Direct measurement of vitamin K epoxide reduction to vitamin K quantifies the enzymatic activity that supports carboxylation . This assay can be performed on tissue homogenates or with purified recombinant enzymes.

  • Cell-based reporter assays: Systems using Factor IX or Factor X-protein C chimeras as reporter proteins provide quantitative measurement of γ-carboxylation in cellular contexts .

How should researchers design experiments to differentiate between the physiological roles of VKORC1 and VKORC1L1?

To effectively differentiate between the physiological roles of VKORC1 and VKORC1L1, researchers should consider the following experimental design strategies:

  • Tissue-specific analyses: Given the variable contribution of VKORC1L1 to VKOR activity across tissues, comprehensive analysis of multiple tissues is essential. Special attention should be paid to tissues where Vkorc1l1 expression exceeds Vkorc1 (e.g., brain and testes) .

  • Developmental time course studies: As the relative importance of these enzymes changes during development, analyzing samples across multiple developmental stages (embryonic, perinatal, juvenile, adult) is crucial for understanding their temporally regulated functions .

  • Combined genetic approaches: Utilizing single knockouts (Vkorc1-/- or Vkorc1l1-/-) alongside double knockouts (Vkorc1-/-;Vkorc1l1-/-) and rescue models (e.g., APOE-Vkorc1l1 transgenic mice) provides a comprehensive picture of functional redundancy and unique roles .

  • Differential inhibition studies: Exploiting the approximately 50-fold difference in sensitivity to vitamin K antagonists between VKORC1 and VKORC1L1 allows for pharmacological differentiation of their activities .

  • Stress conditions: While Vkorc1l1-/- mice show no obvious phenotype under normal conditions, challenging these mice with oxidative stress or vitamin K deficiency may reveal conditional phenotypes not evident under physiological conditions .

What are the key considerations when interpreting data from VKORC1L1 knockout or overexpression studies?

When interpreting data from VKORC1L1 knockout or overexpression studies, researchers should consider several important factors:

  • Functional redundancy: The significant functional overlap between VKORC1 and VKORC1L1 means that phenotypes may be masked by compensation. The absence of an obvious phenotype in Vkorc1l1-/- mice does not necessarily indicate lack of function .

  • Tissue specificity: The contribution of VKORC1L1 to total VKOR activity varies substantially between tissues. Effects of knockout or overexpression will likely be more pronounced in tissues where VKORC1L1 makes a larger contribution to total activity .

  • Developmental timing: The relative importance of VKORC1L1 changes during development, with greater significance during pre- and perinatal periods. Age-appropriate analyses are essential for capturing relevant phenotypes .

  • Expression level assessment: When interpreting overexpression studies, the actual level of functional protein (not just mRNA) should be quantified relative to endogenous levels. Even modest overexpression (e.g., 4% of normal VKORC1 levels) can have significant functional effects .

  • Multiple readouts: Comprehensive assessment should include enzymatic activity measurements (VKOR assay), protein carboxylation status (α-Gla Western blot), specific protein carboxylation (protein-specific Western blot), and functional outcomes (e.g., coagulation tests) .

What are the unresolved questions regarding VKORC1L1's physiological functions?

Despite significant advances in understanding VKORC1L1, several important questions remain unresolved:

How might the development of specific VKORC1L1 inhibitors impact research and potential therapeutic applications?

The development of specific VKORC1L1 inhibitors would have significant implications:

  • Mechanistic studies: Specific inhibitors would provide powerful tools for dissecting the relative contributions of VKORC1 and VKORC1L1 to vitamin K-dependent processes in various tissues and developmental stages .

  • Pharmacological considerations: The search results indicate that current vitamin K antagonists like warfarin predominantly target VKORC1 while having limited effects on VKORC1L1-mediated processes . Specific VKORC1L1 inhibitors would allow for targeted manipulation of processes dependent on this enzyme.

  • Potential therapeutic applications: If VKORC1L1 is found to play specific roles in pathological processes, targeted inhibitors might offer therapeutic opportunities with potentially fewer side effects than current vitamin K antagonists .

  • Safety assessment: Given that VKORC1L1 likely contributes to vitamin K-dependent processes in extrahepatic tissues, the potential pharmaco-toxicologic effects of specific VKORC1L1 inhibitors would need careful assessment . The relatively normal phenotype of Vkorc1l1-/- mice suggests inhibition might be well-tolerated, but conditional phenotypes under stress conditions cannot be ruled out.

  • Combination therapies: Understanding the interplay between VKORC1 and VKORC1L1 inhibition could lead to optimized combination therapies that more precisely target specific vitamin K-dependent processes while sparing others.

What novel methodologies could advance our understanding of VKORC1L1 function in different physiological contexts?

Several emerging methodologies could significantly advance our understanding of VKORC1L1 function:

  • Tissue-specific conditional knockout models: Creating tissue-specific and inducible Vkorc1l1 knockout models would allow for more precise dissection of its functions in different tissues and developmental stages without the confounding effects of compensatory mechanisms during development.

  • Single-cell analysis technologies: Applying single-cell RNA sequencing and proteomics to investigate cell-specific expression patterns of VKORC1L1 and vitamin K-dependent proteins could reveal previously unrecognized functions in specific cell populations.

  • Advanced imaging techniques: Developing tools to visualize VKORC1L1 localization and activity in live cells and tissues would provide insights into its subcellular distribution and functional compartmentalization.

  • Structural biology approaches: Determining the three-dimensional structure of VKORC1L1 would facilitate understanding of its mechanism of action, substrate specificity, and the molecular basis for its reduced sensitivity to vitamin K antagonists compared to VKORC1.

  • Systems biology approaches: Integrating data from multiple omics platforms (genomics, transcriptomics, proteomics, metabolomics) could help identify networks and pathways influenced by VKORC1L1 activity beyond the currently recognized vitamin K cycle.

  • Organ-on-chip technologies: These emerging platforms could allow for more physiologically relevant investigation of VKORC1L1 function in complex tissue environments that better recapitulate in vivo conditions.

VKOR Activity Comparison Between VKORC1 and VKORC1L1

Tissue/ConditionVKORC1 Contribution (%)VKORC1L1 Contribution (%)Notes
P0 Wild-type Liver>99.6%0.4%Based on activity in Vkorc1-/- livers
P0 Vkorc1-/-;Vkorc1l1+/- Liver0%0.1%Reduced VKORC1L1 further decreases activity
Extrahepatic tissuesVariableHigher than in liverParticularly in testis, lung, and osteoblasts
APOE-Vkorc1l1 Transgenic Liver0% (in Vkorc1-/- background)2.6% of WT activitySufficient for rescuing carboxylation

Development-Related Expression of VKORC1, VKORC1L1, and VKD Proteins

Developmental StageVKORC1 ExpressionVKORC1L1 ExpressionCoagulation Factor mRNAObservations
Early EmbryonicLowRelatively constantLowVKORC1L1 can support minimal carboxylation
Late Embryonic/PerinatalIncreasingRelatively constantIncreasingVKORC1 begins to dominate VKOR activity
Postnatal (P0-P7)Further increasingRelatively constantFurther increasingVKORC1L1 can partially compensate for VKORC1 deficiency
Post-P7HighRelatively constantHighVKORC1L1 insufficient to support increased carboxylation demands

Vitamin K Antagonist Sensitivity Comparison

EnzymeRelative VKA SensitivityImplications
VKORC1HighPrimary target of clinical anticoagulants
VKORC1L1Approximately 50-fold less sensitiveContributes to limited side effects during anticoagulant therapy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.