Recombinant Mouse Voltage-dependent calcium channel gamma-3 subunit (Cacng3)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

The mouse Cacng3 gene encodes the voltage-dependent calcium channel gamma-3 subunit, a member of the neuronal calcium channel gamma subunit subfamily of the PMP-22/EMP/MP20 family . This protein exhibits remarkable evolutionary conservation, with mouse Cacng3 sharing approximately 97% sequence identity with human CACNG3 in specific regions . The high degree of conservation across mammalian species underscores the fundamental importance of this protein in neuronal physiology.

Cacng3 belongs to a family of calcium channel regulatory subunits that emerged through a complex evolutionary process involving multiple ancient tandem duplications followed by chromosome duplication events . This evolutionary history has resulted in a diverse family of gamma subunits with specialized functions in different tissues and cellular contexts.

PropertyCharacteristics of Mouse Cacng3
Gene FamilyPMP-22/EMP/MP20 superfamily, VGCC gamma subunit subfamily
Homology97% sequence identity with human CACNG3 in key regions
Human Ortholog UniProt IDO60359
Human Ortholog Entrez Gene ID10368
Common Recombinant Fragmentsaa 203-239, aa 271-309

Expression Pattern

Cacng3 exhibits a predominantly neuronal expression pattern, with significant presence in various brain regions . Unlike the muscle-specific γ1 subunit, Cacng3 expression is largely restricted to the central nervous system, emphasizing its specialized role in neuronal function. Expression studies using EST (expressed sequence tag) analysis have identified Cacng3 transcripts in both fetal and adult brain tissues, with additional detection in retinal tissues .

The neuronal expression of Cacng3 follows a developmental trajectory, with most N-Type voltage-dependent calcium channel subunit expression occurring postnatally . This temporal pattern aligns with the critical periods of synaptogenesis and circuit formation, suggesting important roles for Cacng3 in the establishment and maintenance of functional neural networks, particularly in discrete hippocampal fields.

Calcium Channel Regulation

As its name suggests, a primary function of Cacng3 is the modulation of voltage-dependent calcium channels in neurons. Cacng3 serves as an integral membrane protein that stabilizes calcium channels in an inactive (closed) state . This regulatory role is crucial for controlling calcium influx into neurons, thereby influencing neuronal excitability, neurotransmitter release, and calcium-dependent signaling cascades.

Voltage-dependent calcium channels (VDCCs) allow neurons to precisely regulate calcium signaling in functionally discrete cellular compartments . By modulating these channels, Cacng3 contributes to the spatial and temporal specificity of calcium signals, enabling neurons to respond appropriately to various stimuli and participate in complex network activities.

AMPA Receptor Regulation

Beyond its role in calcium channel modulation, Cacng3 functions as a type I transmembrane AMPA receptor regulatory protein (TARP) . This dual functionality places Cacng3 at a critical intersection of calcium signaling and glutamatergic neurotransmission pathways. As a TARP, Cacng3 regulates both the trafficking and channel gating properties of AMPA receptors, which are the primary mediators of fast excitatory synaptic transmission in the brain.

The regulatory influence of Cacng3 on AMPA receptors encompasses several aspects:

  1. Facilitating receptor surface expression and synaptic targeting

  2. Modulating channel kinetics and conductance properties

  3. Influencing receptor pharmacology and sensitivity to modulators

  4. Mediating interactions with postsynaptic scaffolding proteins

Through these mechanisms, Cacng3 contributes significantly to synaptic plasticity, the cellular basis of learning and memory.

Synaptic Function

The combined effects of Cacng3 on both calcium channels and AMPA receptors position this protein as a key modulator of synaptic transmission. Functional annotation and pathway enrichment analyses suggest that Cacng3 influences neuronal communication by regulating various aspects of synaptic transmission . This regulatory role enables precise control of information processing in neural circuits, contributing to higher cognitive functions and adaptive behaviors.

Production Methods

Recombinant mouse Cacng3 protein is typically produced using molecular cloning and heterologous expression systems. Commercial preparations often feature specific fragments rather than the full-length protein, such as amino acids 271-309 or 203-239 . These recombinant fragments serve as valuable tools for antibody validation and functional studies.

The production process generally involves:

  1. Amplification of the target gene sequence from mouse cDNA

  2. Cloning into an appropriate expression vector

  3. Expression in bacterial, insect, or mammalian cell systems

  4. Purification using affinity chromatography techniques

  5. Quality control testing for purity and biological activity

Research Applications

Recombinant mouse Cacng3 protein and its fragments find numerous applications in neuroscience research:

ApplicationDescriptionRecommended Protocol
Antibody ValidationUsed in blocking experiments to confirm antibody specificity100x molar excess of protein fragment relative to antibody; 30 min pre-incubation at room temperature
Protein Interaction StudiesIdentifies binding partners and interaction domainsVarious co-immunoprecipitation and pull-down approaches
Functional ReconstitutionExamines effects on channel properties in controlled systemsIncorporation into artificial membranes or expression in heterologous cells
Structural StudiesFacilitates determination of protein structureX-ray crystallography, cryo-electron microscopy
Therapeutic Target ScreeningEnables discovery of modulators for neurological disordersHigh-throughput screening assays

These research applications contribute to our understanding of Cacng3's molecular mechanisms and potential therapeutic targeting in neurological disorders.

Neurological Disorders

Cacng3 dysfunction has been implicated in several neurological conditions, most notably epilepsy. The gene is considered a susceptibility locus for childhood absence epilepsy, highlighting its importance in maintaining normal neuronal excitability . This association is particularly significant given that Cacng3 shares functional similarities with Cacng2 (stargazin), mutations of which cause absence seizures and ataxia in the stargazer mouse model .

The relationship between Cacng3 and epilepsy stems from its dual regulatory roles:

  1. Dysfunction in calcium channel regulation can lead to aberrant neuronal excitability

  2. Alterations in AMPA receptor trafficking and function may disrupt excitatory/inhibitory balance

  3. Combined effects can contribute to circuit hyperexcitability and seizure generation

These pathophysiological mechanisms underscore the potential of Cacng3 as a therapeutic target for certain forms of epilepsy and possibly other neurological disorders characterized by altered excitability.

Cancer Biology

Interestingly, temozolomide (TMZ), a chemotherapeutic agent commonly used in glioma treatment, increases CACNG3 expression in a dose and time-dependent manner . This observation raises the possibility that upregulation of CACNG3 may contribute to the therapeutic efficacy of TMZ, opening new avenues for targeted therapies.

Functional analyses suggest that CACNG3 might influence glioma development by interfering with synaptic transmission pathways . These findings highlight the complex interplay between neuronal signaling mechanisms and cancer biology, positioning Cacng3/CACNG3 as an intriguing target for further investigation in both contexts.

Comparative Analysis with Other Gamma Subunits

Despite their structural similarities, each gamma subunit exhibits distinct functional properties and expression patterns. While Cacng1 primarily regulates muscle-specific calcium channels, Cacng3 modulates both neuronal calcium channels and AMPA receptors . These functional distinctions arise from subtle variations in protein sequence and interaction domains, allowing for specialized roles in different cellular contexts.

Comparative functional studies reveal that different TARP family members, including Cacng3, exert distinct effects on AMPA receptor properties. These differences contribute to the diversity of excitatory synaptic transmission across brain regions and cell types, enabling precise tuning of neuronal communication based on specific physiological requirements.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Cacng3; Voltage-dependent calcium channel gamma-3 subunit; Neuronal voltage-gated calcium channel gamma-3 subunit; Transmembrane AMPAR regulatory protein gamma-3; TARP gamma-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV
Uniprot No.

Target Background

Function
The Voltage-dependent calcium channel gamma-3 subunit (Cacng3) plays a regulatory role in the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs) within the somatodendritic compartment. It facilitates their targeting to the cell membrane and synapses, while also influencing their gating properties by slowing down their activation, deactivation, and desensitization rates. Cacng3 does not exhibit subunit-specific AMPAR regulation, affecting all AMPAR subunits. It is believed to stabilize the calcium channel in an inactivated (closed) state.
Gene References Into Functions
  1. This study demonstrated that Cacng3 gene expression in the mouse dorsal raphe nucleus plays a role in [insert specific function]. PMID: 22534482
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic characteristics of mouse Cacng3?

Cacng3 belongs to a family of eight closely related genes (Cacng1-8) that encode proteins with four transmembrane segments, cytoplasmic termini, and molecular masses between 25 and 44 kDa . Specifically, human CACNG3 has a calculated molecular weight of 35,549 Da . The protein is expressed exclusively in the brain and is predominantly located within the postsynaptic densities of dendritic structures in hippocampal mossy fiber synapses .

The Cacng3 protein functions as both a regulatory γ subunit for voltage-dependent calcium channels and as a transmembrane AMPA receptor regulatory protein (TARP) . This dual functionality makes it an important component in neuronal signaling pathways and synaptic transmission.

What are the common methods for confirming the expression of recombinant mouse Cacng3?

Several techniques can be employed to confirm the expression of recombinant mouse Cacng3:

  • RT-PCR analysis: Specific primers can be designed to amplify Cacng3 products spanning adjacent exons. To ensure specificity, primers should be validated against other Cacng family members (Cacng2, Cacng4) to confirm they only amplify the target gene .

  • Northern blot analysis: This technique can be used to detect the presence and quantity of Cacng3 mRNA in different tissue samples or to confirm its absence in knockout models .

  • Western blot analysis: Antibodies specific to Cacng3, such as monoclonal antibodies raised against partial recombinant CACNG3, can be used at dilutions of approximately 1:500-1:1000 to detect the protein .

  • Immunohistochemistry: This can be employed to visualize the spatial distribution of Cacng3 in brain tissue sections.

How does Cacng3 differ functionally from other calcium channel gamma subunits?

Cacng3 has distinct functional properties compared to other calcium channel gamma subunits:

Gamma SubunitExpression PatternEffect on Calcium ChannelsEffect on AMPA Receptors
Cacng2 (Stargazin)BrainRegulates P/Q-type Ca2+ channelsAMPAR trafficking and gating
Cacng3Exclusively in brainHyperpolarizes activation and increases inactivation of P/Q-type Ca2+ channelsFunctions as TARP gamma-3
Cacng4Brain and other tissuesNot fully characterizedNot fully characterized
Cacng5Variable tissuesAccelerates kinetics of T-type calcium channel activation/inactivationVariable effects

Functional studies indicate that Cacng3 specifically hyperpolarizes the activation and increases the inactivation of P/Q-type Ca2+ channels when expressed in Xenopus oocytes, with some dependence on other auxiliary channel subunits . This distinct electrophysiological property sets it apart from other gamma subunits like Cacng5, which primarily affects T-type calcium channels .

What are the optimal expression systems and purification strategies for producing functional recombinant mouse Cacng3?

For producing functional recombinant mouse Cacng3, researchers should consider the following approaches:

Expression Systems:

  • HEK-293 cells: Commonly used for expressing mammalian membrane proteins, including calcium channel subunits. These cells provide appropriate post-translational modifications and have been used successfully for expressing other Cacng family members .

  • Xenopus oocytes: Particularly useful for electrophysiological studies. Previous research has demonstrated successful expression of Cacng3 in this system for functional studies of its effects on P/Q-type Ca2+ channels .

Purification Strategies:

  • Affinity chromatography: Adding tags such as GST or His-tag to the recombinant protein. The established approach includes using partial recombinant CACNG3 (amino acids 199-297) with a GST tag for antibody generation and purification .

  • Size exclusion chromatography: This can be used as a secondary purification step to separate the target protein based on molecular size, particularly useful for separating the 35.5 kDa Cacng3 protein from contaminants.

  • Detergent solubilization optimization: As a membrane protein with four transmembrane segments, optimizing detergent conditions is critical for maintaining the native conformation of Cacng3 during purification.

What experimental approaches can resolve the dual functionality of Cacng3 in calcium channel modulation versus AMPA receptor regulation?

Resolving the dual functionality of Cacng3 requires sophisticated experimental designs:

  • Site-directed mutagenesis: Generate mutants with specific alterations in domains hypothesized to interact with either calcium channels or AMPA receptors. This approach can identify which regions of Cacng3 are responsible for each function.

  • Co-immunoprecipitation assays: These can determine whether Cacng3 can simultaneously bind to both calcium channel complexes and AMPA receptor complexes or if these interactions are mutually exclusive .

  • Electrophysiological approaches:

    • Patch-clamp recordings in heterologous expression systems expressing either calcium channels or AMPA receptors with Cacng3

    • Analysis of calcium currents and AMPA receptor-mediated currents in neurons from wild-type versus Cacng3 knockout mice

  • Fluorescence resonance energy transfer (FRET): This technique can reveal the spatial proximity of Cacng3 to calcium channels and AMPA receptors in living cells, helping to resolve whether these interactions occur simultaneously or in different subcellular compartments.

How does alternative splicing affect the function of recombinant mouse Cacng3?

Alternative splicing plays a significant role in modulating Cacng3 function:

  • Identified splice variants: Alternative splicing of Cacng3 has been observed particularly at the 5'-end of the mRNA , suggesting potential functional diversity of the protein.

  • Functional implications: These splice variants may differentially affect:

    • Voltage-dependent properties of calcium channels

    • Interaction with AMPA receptors

    • Subcellular targeting of the protein

  • Methodological approaches to study splice variants:

    • RT-PCR with primers designed to amplify specific splice variants

    • Generation of splice variant-specific antibodies

    • Electrophysiological characterization of each splice variant in heterologous expression systems

    • Computational prediction of structural differences among splice variants

Understanding how alternative splicing affects Cacng3 function requires expressing individual splice variants and comparing their effects on calcium channel properties and AMPA receptor trafficking.

What is the relationship between Cacng3 dysfunction and seizure disorders?

Cacng3 has been implicated in seizure disorders through several lines of evidence:

  • Genetic studies: Cacng3 belongs to the same family as Cacng2, which is disrupted in the stargazer mouse—a model characterized by ataxia and frequent absence seizure episodes .

  • Functional significance: As a regulator of both calcium channels and AMPA receptors, Cacng3 plays crucial roles in maintaining proper neuronal excitability. Dysfunction in either of these roles could potentially lead to hyperexcitability and seizures.

  • Compound mutations: Studies with Cacng4-targeted mutant mice have shown that combining mutations in multiple Cacng genes can produce more severe phenotypes. Notably, mice with mutations in both Cacng2 and Cacng4 rarely survive beyond four weeks, suggesting crucial roles for these proteins in neuronal function .

  • Therapeutic implications: Understanding Cacng3's role in seizure disorders could lead to novel therapeutic approaches targeting the protein's interactions with calcium channels or AMPA receptors.

How can Cacng3 expression patterns be used as biomarkers in brain tumors?

Recent research has revealed important connections between Cacng3 expression and brain tumors:

Researchers can utilize CACNG3 expression analysis in patient samples to:

  • Predict patient prognosis

  • Guide treatment decisions

  • Better understand tumor subtype classification

What controls should be included when studying recombinant mouse Cacng3 function?

When designing experiments to study recombinant mouse Cacng3 function, several essential controls should be included:

  • Specificity controls:

    • Other Cacng family members (especially Cacng2 and Cacng4) to assess specificity of observed effects

    • Primer specificity verification by testing against cDNA clones of Cacng2, Cacng3, and Cacng4

  • Expression level controls:

    • Quantification of protein expression levels to ensure comparable expression between experimental conditions

    • Use of tagged constructs (e.g., GFP fusion proteins) to monitor expression and localization

  • Functional controls:

    • Wild-type Cacng3 versus mutant constructs

    • Cacng3 knockout or knockdown models

    • Heterologous expression systems without Cacng3

  • Antibody specificity controls:

    • Pre-absorption with recombinant antigen

    • Testing in tissues known to be negative for Cacng3

    • Validation in Cacng3 knockout tissue

What are the most effective approaches for studying the phosphorylation of Cacng3 and its impact on protein function?

Studying Cacng3 phosphorylation requires sophisticated methodological approaches:

  • Identification of phosphorylation sites:

    • Mass spectrometry analysis of purified recombinant Cacng3

    • Phospho-specific antibodies for known/predicted sites

    • Bioinformatic prediction of potential phosphorylation sites based on consensus sequences for various kinases

  • Functional consequences of phosphorylation:

    • Site-directed mutagenesis to create phosphomimetic (e.g., Ser to Asp/Glu) or phospho-null (e.g., Ser to Ala) mutants

    • In vitro kinase assays to identify which kinases can phosphorylate Cacng3

    • Electrophysiological recordings to assess how phosphorylation affects calcium channel or AMPA receptor properties

  • Physiological regulation of phosphorylation:

    • Assess phosphorylation status after various neuronal stimulation paradigms

    • Pharmacological manipulation of kinase/phosphatase activities

    • Analysis of phosphorylation in pathological conditions such as seizures or ischemia

Cacng3 contains multiple potential phosphorylation sites that may play regulatory roles in calcium influxes , making this an important area for investigation.

What transgenic approaches are most appropriate for investigating Cacng3 function in vivo?

Several transgenic approaches can be employed to investigate Cacng3 function in vivo:

When designing these models, researchers should consider:

  • The potential for compensation by other Cacng family members

  • The possibility of embryonic lethality

  • The need for appropriate controls, including heterozygous animals and wild-type littermates

How can CRISPR-Cas9 gene editing advance our understanding of Cacng3 function?

CRISPR-Cas9 technology offers several advantages for studying Cacng3:

  • Precise genomic modifications:

    • Introduction of point mutations to study specific domains or phosphorylation sites

    • Creation of reporter knock-ins for visualizing native expression patterns

    • Deletion of specific exons to study splice variant functions

  • High-throughput screening:

    • CRISPR libraries targeting different regions of Cacng3

    • Screening for phenotypes related to calcium channel function or AMPA receptor trafficking

  • In vivo applications:

    • Direct injection of CRISPR constructs into specific brain regions

    • Temporal control of gene editing using inducible Cas9 systems

    • Cell type-specific editing using appropriate promoters

  • Therapeutic potential:

    • Development of gene therapy approaches for conditions with altered Cacng3 function

    • Correction of disease-associated mutations in patient-derived cells

What methodological challenges exist in distinguishing the roles of Cacng3 from other TARP family members?

Several methodological challenges complicate the study of Cacng3-specific functions:

  • Sequence and structural similarity:

    • High homology between Cacng family members (particularly Cacng2-8) makes it difficult to develop truly specific tools

    • Similar molecular weights and expression patterns can confound biochemical analyses

  • Functional redundancy:

    • Multiple TARPs may compensate for the loss of Cacng3 in knockout models

    • Overlapping functions make it difficult to isolate Cacng3-specific effects

  • Methodological solutions:

    • Development of highly specific antibodies validated against multiple Cacng family members

    • Use of multiple knockout or knockdown approaches

    • Rescue experiments with wild-type or mutant Cacng3 in knockout backgrounds

    • Single-cell approaches to address heterogeneity in expression patterns

  • Advanced imaging techniques:

    • Super-resolution microscopy to distinguish spatial localization patterns

    • FRET-based approaches to study specific protein-protein interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.