Recombinant Mouse Voltage-dependent calcium channel gamma-6 subunit (Cacng6)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Cacng6

Recombinant Mouse Cacng6 is a partial or full-length protein expressed in heterologous systems such as E. coli, yeast, or mammalian cells . It belongs to the PMP-22/EMP/MP20 protein family and stabilizes voltage-gated calcium channels (VGCCs) in their inactive state . Key features include:

PropertySpecification
Gene NameCacng6; 2310033H20Rik
Protein NameVoltage-dependent calcium channel gamma-6 subunit
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
Purity≥85% (SDS-PAGE)
Molecular Characteristics260 amino acids, 4 transmembrane domains

Primary Structure

The protein sequence begins with MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT .

Functional Role

  • Channel Regulation: Stabilizes L-type calcium channels containing CACNA1C, modulating calcium influx in excitable cells .

  • Pathological Associations: Linked to aspirin-intolerant asthma (AIA) and schizophrenia risk due to altered expression patterns .

  • Environmental Interactions: Expression is suppressed by endocrine disruptors (e.g., dibutyl phthalate, bisphenol A) and heavy metals (e.g., sodium arsenite) .

Expression and Purification

  • Host Optimization: Highest yields (>85% purity) are achieved in mammalian cell systems, though E. coli is cost-effective for partial constructs .

  • Antigenicity: A 66–134 amino acid fragment is commonly used for antibody validation in Western blot and immunohistochemistry .

Disease Associations

ConditionMechanismCitation
Aspirin-Intolerant AsthmaVariants in Cacng6 correlate with hypersensitivity to NSAIDs .
Schizophrenia (SCZ)Dysregulation alters L-type calcium channel activity in neuronal circuits .
Chronic Obstructive Pulmonary Disease (COPD)Negative association with Cacng6 expression .

Environmental Modulation

  • Downregulation: Observed with exposure to dibutyl phthalate, silicon dioxide, and deoxynivalenol .

  • Upregulation: Triggered by quercetin and silver nanoparticles .

Therapeutic Targets

  • Calcium Channelopathies: Used to study channel inactivation defects in muscular and neurological disorders .

  • Drug Screening: Recombinant Cacng6 enables high-throughput testing of calcium channel modulators .

Experimental Tools

  • Antibody Production: Anti-CACNG6 antibodies (e.g., PA5-66028) validate protein localization in murine tissues .

  • RNA Interference: siRNA constructs silence Cacng6 to assess its role in calcium signaling .

Comparative Biology

Orthologs of Cacng6 are conserved across species, with 91% sequence identity between mouse and human variants . Functional divergence is noted in non-mammalian models, where gamma subunits regulate AMPA receptors .

Future Directions

  • Structural Studies: Cryo-EM analysis of full-length Cacng6 bound to CACNA1C.

  • Clinical Trials: Targeting Cacng6 polymorphisms in AIA patients using CRISPR/Cas9 editing.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Cacng6; Voltage-dependent calcium channel gamma-6 subunit; Neuronal voltage-gated calcium channel gamma-6 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MMWSNFFMQEEDRRRTAVGRRRAQEQQNLGLTPEREGKIKLGLLVAIVGATLAVLAVGTE FWVELNTYKTNGSAVCEAAHLGLWKVCIKRLWQADVPAGRETCGPAELPGEANCTYFKFF TTGENARIFQRTTKKEVNLAAAVIAVLGLTAMALGCLCVIMVLSKGAESLLRLGAVCFGL SGLLLFVSLEVFRHSVGALLQGVNPETPPAPRLAYEYSWSLGCGVGAGLILLLGGVCFLL LTLPSWPWRSLCPKWGGPTA
Uniprot No.

Target Background

Function
Regulates the activity of L-type calcium channels that contain CACNA1C as the pore-forming subunit.
Gene References Into Functions
  1. This study demonstrated that Cacng6 gene expression in mouse dorsal raphe nucleus PMID: 22534482
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain and heart (at protein level).

Q&A

What is the basic structure of the Cacng6 protein?

Cacng6 (voltage-dependent calcium channel gamma-6 subunit) is a member of the calcium channel gamma subunit family. The protein contains four transmembrane domains with short intracellular N- and C-terminus. The first transmembrane domain contains a specific GxxxA motif that is critical for the inhibitory function of Cacng6 . The full-length mouse Cacng6 protein consists of approximately 260 amino acids, sharing significant homology with human CACNG6 . The protein's structure is optimized for its role in calcium channel regulation, with the extracellular domains being particularly important for interactions with other channel components.

What is the primary function of Cacng6 in calcium channels?

Cacng6 functions primarily to stabilize voltage-dependent calcium channels during their inactive state . It is a regulatory subunit that modulates the activity of L-type calcium channels containing CACNA1C as the pore-forming subunit . When co-expressed with low voltage-activated Ca²⁺ channels, Cacng6 has been shown to decrease Ca²⁺ currents . This regulatory function is crucial for proper calcium signaling in excitable cells, where precise control of calcium influx is necessary for numerous physiological processes including muscle contraction, neuronal signaling, and cellular development.

Where is Cacng6 predominantly expressed?

Cacng6 is predominantly expressed in striated muscle cells, with high expression levels in both skeletal and cardiac muscles . Lower expression levels have been detected in brain tissue, where it appears as a separate isoform . Understanding the tissue-specific expression pattern is crucial for designing relevant experimental models and interpreting results in different physiological contexts. When studying Cacng6 in non-native tissues, researchers should consider the absence of natural binding partners that may affect protein behavior.

What are the optimal expression systems for producing recombinant mouse Cacng6?

Multiple expression systems have been successfully used to produce recombinant mouse Cacng6, including E. coli, yeast, baculovirus, and mammalian cell systems . Each system offers distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionMay lack proper post-translational modifications
YeastBetter post-translational modifications than bacteriaModerate yield, more complex cultivation
BaculovirusMammalian-like post-translational modificationsHigher cost, longer production time
Mammalian cellNative folding and modification patternsHighest cost, lowest yield, most time-consuming

The choice of expression system should be based on the specific research requirements. For structural studies requiring large protein quantities, bacterial or yeast systems may be preferable. For functional studies where proper folding and modifications are crucial, mammalian or baculovirus systems are recommended .

What purification strategies are most effective for recombinant mouse Cacng6?

Purification of recombinant mouse Cacng6 typically requires a multi-step approach due to its membrane protein nature. Standard purification protocols achieve ≥85% purity as determined by SDS-PAGE . An effective purification strategy involves:

  • Cell lysis with detergent-containing buffers optimized for membrane protein extraction

  • Initial purification using affinity chromatography (typically His-tag based)

  • Additional purification steps using ion exchange or size exclusion chromatography

  • Quality assessment through SDS-PAGE and Western blotting

Researchers should be aware that the choice of detergent is critical, as it must maintain protein stability while effectively solubilizing the membrane-embedded protein. Mild detergents like DDM (n-dodecyl β-D-maltoside) often provide a good balance between extraction efficiency and protein stability.

How can researchers verify the functionality of purified recombinant Cacng6?

Functional validation of recombinant Cacng6 requires assessment of its ability to modulate calcium channel activity. Several approaches can be employed:

  • Co-expression with calcium channel subunits (particularly CACNA1C) in heterologous systems followed by electrophysiological recordings

  • Binding assays with known interaction partners

  • Structural integrity assessment through circular dichroism or other biophysical techniques

  • Assessment of inhibitory function on calcium currents in patch-clamp experiments

A functional recombinant Cacng6 protein should demonstrate its characteristic inhibitory effect on calcium currents when co-expressed with appropriate channel subunits .

How can Cacng6 be used in structural studies of calcium channel complexes?

For structural studies of calcium channel complexes incorporating Cacng6:

  • High-purity recombinant Cacng6 (≥85% as verified by SDS-PAGE) is essential

  • Co-expression or reconstitution with other channel subunits may be necessary to achieve stable complexes

  • Cryo-electron microscopy (cryo-EM) has emerged as a preferred method for membrane protein complexes

  • X-ray crystallography may require stabilization strategies such as antibody-mediated crystallization or fusion partners

Researchers should consider using anti-CACNG6 antibodies that recognize extracellular epitopes to aid in structural studies of intact complexes . These antibodies can help stabilize the protein conformation or provide additional surfaces for crystal contacts.

What experimental approaches can elucidate the interaction between Cacng6 and other calcium channel subunits?

To study interactions between Cacng6 and other calcium channel components:

  • Co-immunoprecipitation using antibodies against Cacng6 or other channel subunits

  • FRET-based assays with fluorescently tagged subunits to monitor interactions in living cells

  • Surface plasmon resonance to quantify binding kinetics between purified components

  • Cross-linking coupled with mass spectrometry to identify precise interaction sites

  • Mutagenesis studies targeting the first transmembrane domain with the GxxxA motif, which is critical for Cacng6 function

The extracellular domains of Cacng6 are particularly important for channel modulation, making antibodies that recognize these regions valuable tools for functional disruption experiments .

How do polymorphisms in Cacng6 affect calcium channel function?

Research on polymorphisms in the Cacng6 gene has revealed:

  • Several SNPs have been identified, including promoter variants and intronic polymorphisms

  • Methodological approach to studying polymorphisms typically includes:

    • Genotyping using TaqMan assays or similar technologies

    • Calculation of linkage disequilibrium between pairs of biallelic loci

    • Use of algorithms like PHASE for haplotype inference

    • Statistical analysis including logistic regression adjusted for relevant covariates

Studies have shown that variations in the human CACNG6 gene are associated with certain conditions like aspirin-intolerant asthma . Similar approaches can be applied to investigate the functional consequences of mouse Cacng6 polymorphisms on calcium channel properties.

What are the key differences in studying Cacng6 in muscle versus neuronal tissues?

When investigating Cacng6 across different tissue types:

Tissue TypeExpression LevelFunctional RoleExperimental Considerations
Skeletal MuscleHighPrimary regulation of skeletal muscle calcium channelsConsider fiber-type specific expression patterns
Cardiac MuscleHighModulation of cardiac excitation-contraction couplingMust account for beat-to-beat regulation
BrainLow (specific isoform)Potential role in neuronal excitabilityMay require more sensitive detection methods

Immunohistochemical studies in rat brain tissues have shown Cacng6 staining in the pyramidal layer of the cingulate cortex, suggesting specific neuronal localization patterns . When designing tissue-specific experiments, researchers should account for these expression differences and consider using tissue-specific promoters for transgenic or viral expression systems.

How can researchers isolate native Cacng6 from mouse tissues for comparative studies?

For isolation of native Cacng6 from mouse tissues:

  • Tissue selection should prioritize skeletal and cardiac muscle due to high expression levels

  • Membrane protein extraction requires specialized buffers containing appropriate detergents

  • Immunoprecipitation using anti-CACNG6 antibodies that recognize extracellular epitopes can yield native protein complexes

  • Western blot analysis can verify isolation success, with expected bands at the appropriate molecular weight

  • Native protein can then be compared to recombinant versions through functional or structural analyses

When performing Western blot analysis, researchers should be aware that preincubation with CACNG6 extracellular blocking peptide can serve as a specificity control for the antibody .

How does Cacng6 contribute to calcium channel physiology in the broader context of cellular signaling?

Voltage-dependent calcium channels containing Cacng6 are critical regulators of calcium influx and influence numerous physiological processes:

  • Synaptic transmission in neurons

  • Muscle contraction in skeletal and cardiac tissues

  • Neurogenesis and developmental processes

  • Hormone secretion

  • Cell motility and division

Research approaches to understand Cacng6's role in these broader contexts include:

  • Transgenic mouse models with Cacng6 modifications

  • Tissue-specific conditional knockouts

  • Electrophysiological recordings in native tissues

  • Calcium imaging combined with pharmacological manipulation

  • Computational modeling of calcium channel dynamics with and without Cacng6

What computational models best capture Cacng6's influence on calcium channel kinetics?

Computational modeling of Cacng6's effects on calcium channel function should account for:

  • The stabilization of calcium channels in their inactive state

  • Reduction of calcium currents when co-expressed with low voltage-activated Ca²⁺ channels

  • Structural features including the critical GxxxA motif in the first transmembrane domain

  • Tissue-specific expression patterns and interaction partners

Markov models with multiple closed states can effectively capture the stabilization of inactive states mediated by Cacng6. These models should incorporate state-dependent transitions influenced by membrane potential, which can be parameterized based on electrophysiological data from recombinant systems expressing controlled amounts of Cacng6 and other calcium channel subunits.

What are the most significant unresolved questions regarding Cacng6 function in calcium channels?

Despite significant progress in understanding Cacng6, several important questions remain:

  • The precise molecular mechanism by which Cacng6 stabilizes the inactive state of calcium channels

  • The complete interactome of Cacng6 in different tissue contexts

  • The functional significance of brain-specific Cacng6 isoforms

  • The potential role of Cacng6 in calcium channelopathies and related disorders

  • The evolutionary conservation of Cacng6 function across species

Addressing these questions will require integrative approaches combining structural biology, electrophysiology, proteomics, and genetic models. The continued development and refinement of recombinant Cacng6 production systems will be essential for these future research directions.

What emerging technologies might advance Cacng6 research in the near future?

Several emerging technologies promise to accelerate Cacng6 research:

  • Cryo-electron microscopy for high-resolution structures of calcium channel complexes containing Cacng6

  • Single-molecule FRET to study conformational dynamics of channels with and without Cacng6

  • CRISPR-Cas9 gene editing for precise manipulation of Cacng6 in animal models

  • Optogenetic approaches to control calcium channel activity in conjunction with Cacng6 modulation

  • Advanced computational modeling incorporating molecular dynamics simulations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.