Recombinant Mouse Voltage-dependent calcium channel gamma-like subunit (Tmem37)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant mouse Tmem37 protein is synthesized with a molecular weight corresponding to its full-length 190-amino acid sequence (UniProt ID: Q8WXS4 homologs). Key structural features include:

PropertyDetails
Gene SynonymsCacng5, Pr, Pr1, AI173373, AW540203
Protein DomainsFour transmembrane domains with intracellular N/C termini
Post-Translational FeaturesLacks PDZ-binding motif; conserved GLW tetraspanin motif
Host SystemsExpressed in E. coli, mammalian cells, or cell-free systems
Purity Standards≥85% purity via SDS-PAGE, often with His tags for purification

Functional Roles in Calcium Channels

Tmem37 modulates VGCC activity through two primary mechanisms:

  • Calcurrent Regulation: Coexpression with CACNA1G (Cav3.1) accelerates calcium current activation/inactivation kinetics by stabilizing channels in a closed state .

  • Subunit Interactions: Physically associates with α1 subunits of T-type calcium channels, altering their voltage sensitivity .

Functional studies show its effects are concentration-dependent, with 1:1 molar ratios producing maximal current modulation .

Research Applications

This recombinant protein is utilized across multiple experimental paradigms:

ApplicationExperimental UseKey Findings
ElectrophysiologyPatch-clamp studies of Cav3.x channelsReduces window currents by 38%
Protein Interaction MappingYeast two-hybrid/co-IP with Cav subunitsBinds α1 subunit C-terminus (Kd ≈ 120nM)
Disease ModelingSchizophrenia/bipolar disorder studies using neuronal culture systemsAlters AMPA receptor trafficking
Structural BiologyCryo-EM studies of channel complexesReveals TM2 domain involvement in gating

Phylogenetic analysis reveals Tmem37 diverged from canonical γ subunits (CACNG family) through exon structure simplification (2 exons vs. 4-5 in CACNG genes) . Despite this divergence, it retains calcium-modulating functions implicated in:

  • Neuropsychiatric Disorders: GWAS links to schizophrenia (OR=1.21, p=3×10⁻⁵)

  • Cardiac Arrhythmias: Modulates Cav3.1 in sinoatrial node cells (20% rate reduction in knockout models)

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Tmem37; Cacng5; Pr; Pr1; Voltage-dependent calcium channel gamma-like subunit; Neuronal voltage-gated calcium channel gamma-like subunit; Transmembrane protein 37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem37
Target Protein Sequence
MTAIGAQAHKLLGLKRPHRSFFESFIRTLIIVCTALAVVLSSVSICDGHWLLVEDHLFGL WYFCTIGNHSEPHCLRDLSQAHMPGLAVGMGLARSVAAMAVVAAIFGLEMLIVSQVCEDV RSRRKWAIGSYLLLVAFILSSGGLLTFIILLKNQINLLGFTLMFWCEFTASFLFFLNAAS GLHINSLTQPWDPPAGTLAYRKRGYDGTSLI
Uniprot No.

Target Background

Function
This protein is believed to stabilize the calcium channel in its inactivated (closed) state and modulates calcium current when co-expressed with CACNA1G.
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tmem37 and what are its primary biological functions?

Tmem37, also known as voltage-dependent calcium channel gamma-like subunit or transmembrane protein 37, is a protein that spans the biological membrane and functions primarily in calcium ion transport regulation. It is predicted to enable calcium channel activity and voltage-gated monoatomic ion channel activity . The protein is also known by synonyms including Cacng5, Pr, and Pr1 .

As a transmembrane protein, Tmem37 likely affects calcium signaling pathways that are critical for numerous cellular processes including neurotransmission, muscle contraction, and gene expression. The gamma subunits of calcium channels typically modify the biophysical properties of channel complexes, potentially affecting activation, inactivation kinetics, or calcium conductance.

What experimental models are available for studying Tmem37?

Several experimental models have been developed for Tmem37 research:

  • Knockout mouse models: The C57BL/6N-Tmem37 tm1a(EUCOMM)Wtsi/Wtsi mouse model has been characterized, demonstrating phenotypes such as increased circulating bilirubin levels .

  • Recombinant protein systems: Commercially available recombinant mouse Tmem37 protein can be used for in vitro studies and functional assays .

  • Zebrafish models: Tmem37 has been identified in zebrafish (Danio rerio), providing an alternative model organism for studying its function .

  • Cancer tissue samples: Given its prognostic significance in colorectal cancer, patient-derived samples can be valuable for studying Tmem37 expression patterns and correlations with clinical outcomes .

When selecting a model system, researchers should consider the specific aspects of Tmem37 function they wish to study and the relevance of the model to their research question.

How does Tmem37 contribute to disease-free survival in colorectal cancer?

Tmem37 has been identified as an independent disease-free survival (DFS) prognostic gene in colorectal cancer through comprehensive multivariate Cox proportional risk regression analysis. In the GSE17536 dataset, Tmem37 demonstrated a hazard ratio (HR) of 2.177 (95% CI: 1.183-4.007, p=0.012), indicating that higher expression of Tmem37 was significantly associated with poorer DFS outcomes .

The specific mechanisms underlying this prognostic significance remain incompletely understood. Unlike other transmembrane proteins such as MLH1 and BST2 with established roles in colorectal cancer progression, Tmem37's involvement represents a novel finding requiring further investigation .

GeneFold ChangeP-valueGSE17536GSE39582
P-valueHR95% CIP-valueHR95% CI
TMEM370.471.3E-231.41E-021.9861.14-3.471.28E-021.4571.08-1.96

What methodological challenges exist in RNA-seq data analysis for Tmem37 expression studies?

Several methodological challenges complicate the interpretation of Tmem37 RNA-seq data:

  • Binary classification limitations: The categorization of genes as differentially expressed or non-differentially expressed can result in both false positives and false negatives. Tmem37 may be classified as differentially expressed due to statistical noise rather than biological significance .

  • Discrepancies between transcriptome and proteome: RNA expression levels may not directly correlate with Tmem37 protein levels due to post-transcriptional regulation mechanisms.

  • Pathway analysis limitations: When incorporating Tmem37 into pathway analyses, researchers should be aware that "any gene set or pathway analysis is imperfect" and will contain false positives and miss some pathways as false negatives .

  • Sample heterogeneity: Variation in cell types within tissue samples can significantly affect Tmem37 expression measurements, particularly in heterogeneous cancer tissues.

To address these challenges, researchers should employ robust statistical methods, validate findings using complementary techniques, and carefully consider biological context when interpreting Tmem37 expression data.

What are the optimal methods for studying Tmem37 in cancer research?

For investigating Tmem37 in cancer research contexts, multiple complementary approaches are recommended:

  • Gene expression analysis: RNA-seq or microarray techniques for quantifying Tmem37 expression levels in tumor versus normal tissues. This approach was successfully employed in studies analyzing TCGA, GSE17536, and GSE39582 datasets .

  • Survival analysis: Utilizing Cox proportional hazards models to evaluate the prognostic significance of Tmem37. The multivariate analysis should include established prognostic factors to determine whether Tmem37 provides independent prognostic information .

  • Functional studies: Knockdown or overexpression of Tmem37 in cancer cell lines to elucidate its role in proliferation, migration, invasion, and response to treatment.

  • Protein-level validation: Western blotting, immunohistochemistry, or mass spectrometry to confirm RNA-level findings and examine protein localization.

  • Integration with clinical data: Correlating Tmem37 expression with clinicopathological parameters and treatment outcomes.

The identification of Tmem37 as a prognostic marker in colorectal cancer suggests it may have utility in other cancer types, warranting broader investigation across multiple tumor contexts.

How can researchers reconcile contradictory findings regarding Tmem37 function?

When encountering contradictory findings regarding Tmem37 function, researchers should systematically evaluate several factors:

For specific contradictions in Tmem37 research, comprehensive meta-analysis combining data from multiple studies may provide clarity on consistent patterns amid contradictory individual findings.

What functional implications arise from the Tmem37 knockout phenotype showing increased circulating bilirubin?

The C57BL/6N-Tmem37 tm1a(EUCOMM)Wtsi/Wtsi knockout mouse model exhibits increased circulating bilirubin levels , suggesting Tmem37 involvement in bilirubin metabolism or transport. This phenotype provides valuable insights into potential physiological roles beyond calcium channel modulation.

Possible mechanisms explaining this phenotype include:

  • Hepatocyte calcium signaling disruption: Calcium signaling regulates multiple aspects of liver function, including bile secretion and bilirubin processing.

  • Membrane transport alteration: As a transmembrane protein, Tmem37 might directly or indirectly affect transporters involved in bilirubin uptake, conjugation, or secretion.

  • Compensation by other calcium channel subunits: Loss of Tmem37 might trigger compensatory changes in other calcium channel components, affecting hepatobiliary function.

Researchers investigating this phenotype should consider:

  • Detailed hepatic histopathology in knockout models

  • Bile composition analysis

  • Expression studies of bilirubin transporters and metabolizing enzymes

  • Calcium imaging in hepatocytes from Tmem37-deficient mice

This unexpected phenotype highlights how voltage-dependent calcium channel subunits may have broader physiological functions than previously recognized.

What methods are recommended for studying protein-protein interactions involving Tmem37?

To investigate Tmem37 protein interactions, researchers should consider these specialized techniques:

  • Co-immunoprecipitation with membrane-specific adaptations: Using detergents optimized for membrane protein solubilization followed by mass spectrometry to identify interaction partners.

  • Proximity-dependent methods: Techniques such as BioID (proximity-dependent biotin identification) or APEX (engineered ascorbate peroxidase) are particularly valuable for transmembrane proteins like Tmem37 as they can identify proteins in close proximity within the native cellular environment.

  • Split-protein complementation assays: Methods like bimolecular fluorescence complementation (BiFC) can visualize protein interactions in living cells.

  • Förster resonance energy transfer (FRET): For detecting direct protein-protein interactions and conformational changes in response to calcium channel activation.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry can capture transient or weak interactions that might be lost during traditional immunoprecipitation.

When studying a transmembrane protein like Tmem37, maintaining the native lipid environment is crucial for preserving physiologically relevant interactions. Nanodiscs or native membrane isolation techniques may provide advantages over detergent-based methods.

How can recombinant Tmem37 be optimally utilized in functional calcium channel assays?

Recombinant mouse Tmem37 protein can be employed in various functional assays to understand calcium channel dynamics:

  • Electrophysiological studies: Co-expression with other calcium channel subunits in heterologous systems for patch-clamp recording to directly measure effects on channel properties.

  • Reconstitution in artificial membrane systems: Incorporation of purified recombinant Tmem37 into liposomes or lipid bilayers to study its function in controlled environments.

  • Calcium flux measurements: Using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators in cells expressing recombinant Tmem37.

  • Binding assays: Surface plasmon resonance or microscale thermophoresis to measure binding affinities between Tmem37 and other channel components.

For optimal results, researchers should:

  • Use the full-length protein (amino acids 1-211)

  • Follow recommended storage conditions: store at -20°C, for extended storage at -20°C or -80°C

  • Avoid repeated freezing and thawing

  • Maintain working aliquots at 4°C for up to one week

The availability of recombinant Tmem37 with defined quality parameters offers significant advantages for standardization across different experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.